KEGG   Pyrobaculum aerophilum: PAE0583Help
Entry
PAE0583           CDS       T00073                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pai  Pyrobaculum aerophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pai00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313492..314502)
Genome map
AA seq 336 aa AA seqDB search
MRFPVTRPRRLRASKLIREAVAETSLDSSDFIYPIFVKPSGPREPISSMPGQYRWPVGEE
LVKHVEEALSLGVNKVILFGVVPDEVKDAQGSPGYDPQGVVPKAIRLLKEAFGDKLLIFA
DVCLCEYTEHGHCGVVRERRGRWYVDNDETIKLYAKEAVAYADAGADFVAPSGMMDGQVA
EIRKALDSHGFHDVGIMAYSAKYASAFYGPFRVAAASAPKFGDRRTYQMDPRNAYEAVKE
VMLDLEEGADIVMVKPALAYLDVIKIVKTHYPWAPLAAYNVSGEYAMVKAAASLGYIDER
VVTLEILTAIKRAGANLILTYHALEAARWLKEGSPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagatttccagttacaaggcctaggaggcttagggcgagcaagctcattagggaagca
gtggcggagacctcgctggattcaagcgattttatatatcctatatttgtcaagccttcc
gggccgagggagcccatctcctcaatgcccgggcagtacagatggcccgttggcgaggag
ttggtgaaacacgttgaggaggccctatccctaggagtaaacaaagtgattttattcggc
gttgttccagacgaagtaaaagacgcccaaggctctccaggctacgacccccagggggtt
gttcccaaggcaatccgccttttaaaagaggcgtttggcgacaagttattaatattcgcc
gacgtatgtctctgcgagtatacagaacacggccactgcggcgttgtgagggagaggagg
gggaggtggtacgtggacaacgacgagactataaaactatacgcaaaagaggctgtggcg
tatgcagacgcgggggcggacttcgtcgcgcctagtggcatgatggatggacaagtggcg
gagataagaaaggcgctggactcccatgggtttcacgacgtggggattatggcctacagc
gccaaatacgcctcggcgttttacgggcctttcagagtggccgctgcctcggcgcctaaa
tttggcgataggaggacttaccaaatggatcccagaaacgcctatgaggcggtgaaggag
gtaatgttagacttggaagagggggcggatatagttatggtaaagccggcgctggcgtat
ttagacgtcattaaaatcgtgaagactcactacccctgggcccccttagccgcctacaac
gtatcaggggagtacgccatggtgaaagccgccgcctccctcggctatatagacgagcgc
gtagtaacgctggagatacttacggcgataaagagggcaggcgccaacttaatactaacg
taccacgcgttagaggcggcgaggtggttgaaagagggctcacctttttaa

DBGET integrated database retrieval system