KEGG   Pyrobaculum aerophilum: PAE0701Help
Entry
PAE0701           CDS       T00073                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pai  Pyrobaculum aerophilum
Brite
Enzymes [BR:pai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PAE0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
385857..386474
Genome map
AA seq 205 aa AA seqDB search
MAKRLVEELERDGIVKSERVKRALLTVPREEFVLPEYRMMAYEDRPLPLFAGATISAPHM
VAMMCELIEPRPGMKILEVGTGSGYHAAVCAEAIEKKGRIYTIEIVKELAVFAAQNLERL
GYWGVVEVYHGDGKKGLEKHAPFDAIIVTAAADVIPPALIRQLKDGGVMVIPVEERLGQV
LYKVVKRGDKIEKKAITYVMFVPLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagacttgtagaggagttagaacgcgacggaattgtaaaaagcgagagagta
aaaagggcattgcttaccgtaccccgcgaggaattcgtcttgccggaataccgcatgatg
gcttatgaggacaggccgcttccgctgtttgccggcgctactatttccgcgcctcatatg
gtcgccatgatgtgcgagctaatcgagccccggccggggatgaaaatactagaggtgggc
actggctcaggataccacgcggccgtctgcgccgaggctattgagaaaaaggggaggatt
tacacaatagagatagtaaaagaactcgcagtattcgccgcgcagaatttagaaaggctg
ggctactggggagtcgtagaggtataccacggagatgggaaaaaagggttggagaaacac
gcgccgtttgacgccataatcgtcaccgcagccgccgacgttatacccccagcgcttata
aggcagttaaaagacggcggcgttatggtcatcccagttgaggagcggttgggccaagta
ttatacaaagtagtaaaaagaggggataagatcgagaagaaggccataacttatgttatg
ttcgtgccgctaagatga

DBGET integrated database retrieval system