KEGG   Pyrobaculum aerophilum: PAE0835Help
Entry
PAE0835           CDS       T00073                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pai  Pyrobaculum aerophilum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAE0835
Enzymes [BR:pai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAE0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481582..482499
Genome map
AA seq 305 aa AA seqDB search
MIVASIGNLNFDIYLKVSELPGPDENVEALDLYTGGGGSAANFAVAIAKMGLSARFIGAV
GEDPLGEISLRELRAEGVDVSFVKRVRGVRSGVVVVLVHPDGVKRMVSYRGANLGLTPAD
LTVDKFAGVKHIHLATGRTELILKAKEIAREIGASISVDGGTALARKGLEIVRAAVEGVD
VVFMNHVEAQLVANAGDHKSAVEKLARELKVGELVVTLGPIGAVAFKNGRLLHVDAFKVN
AVDTTGAGDCFAAAYITMYLRGRDLYERLLFANAAAAIKVTRPSARASPRYDEVVAFLES
LGYKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgatagtcgcctctattggcaatttaaatttcgatatctatctaaaagtctccgagttg
ccggggcctgatgaaaacgttgaagctcttgatttatatacaggcggcggcggatcggcc
gcgaatttcgccgtggctattgctaaaatggggctcagcgctaggtttatcggcgcagtg
ggggaggacccgctgggggagatctctctgagggagttaagggctgagggagtggacgtg
tcttttgtgaaaagagtgaggggcgttaggtcgggcgtagttgtggtattagtccaccca
gacggcgtgaagagaatggtgtcctaccggggggctaacctaggcctcacgccggctgat
ctcacagtggataaattcgcgggggttaaacatatacacttagccacggggaggactgag
cttatattaaaggccaaggagatcgccagggaaataggcgcgagtatttcagtagatggg
gggacggctcttgccagaaagggccttgaaatcgtgagggcggccgtggagggcgtcgac
gtggtatttatgaaccacgtggaggcgcaacttgtggcaaacgccggcgatcacaaatcc
gcggtcgaaaaactggccagagaattaaaggtgggggagctagtcgttaccctaggtcct
attggcgcagtggcttttaaaaacggcaggttgttacacgtagacgcgtttaaagtaaac
gcggtggacaccacgggggccggcgactgttttgcagccgcttacataacaatgtatcta
agagggagagatctatacgagcggcttttattcgcaaacgcggccgccgctattaaagtc
acaaggcccagcgctagggcctcgccgcgttacgatgaagtagtggcgtttctcgaatct
cttggctacaagatttaa

DBGET integrated database retrieval system