KEGG   Pyrobaculum aerophilum: PAE0922Help
Entry
PAE0922           CDS       T00073                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pai  Pyrobaculum aerophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(532338..533753)
Genome map
AA seq 471 aa AA seqDB search
MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIK
VYIENGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQ
IRNETAELRMVALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAA
EVVEATAILKDSAYKVCYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPN
TELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQ
IVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDD
TLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggagtccacgtagttgcgctaatgacacagcccttcccctgccccgggcgg
tgcaccttctgcccctcctcggcggacgcccctaagtcttacatgccggacagccccgtt
gtgctccgggccaagaggaataggtacgacccctacttacaaacggcggggaggataaaa
gtttatattgaaaacggccacactccctctaaaatagaggctgtgataatgggcggaacc
ttcagcgccttgccgcgtggctaccgggagtggtttgtggcaaatatatacaaagcgctt
aacgacttcccccactggacctcttcagccgacccaacgcctaatttagaggctgagcag
atcagaaacgaaactgcagagctccgcatggtggcgttaaccgtggagacccggccggac
tttataaacaaggccgaggtggacttcctccttaaactcggcgtgacgagggtagagctg
ggcgttcaatctatttacgacgacgtgttgcaaaaagtgaagaggggacacggcgcggct
gaggtcgttgaggcaacggcgattcttaaagactcggcgtataaggtgtgttaccacgta
atgccgggcctccccgggagcgacccagaccgcgatttggaaatggttagggagattttc
tccaatcccagctacatgcccgactgcgtgaaaatataccccctctacgtcgtgccaaat
acagagctttctgaagactggcgtcgcggtctttataaaagctacgacgaagagacttgg
ctagagcttctagctaaaatatacgcatctatcccccgctgggtcagagtaatgaggttt
ggcagagacatcccactccaccacgtcctcgacgggcccaggtggggcaatatgcggcaa
atagtgttgaaacacatggagagattgggtcttaagtgccaggagattaggtgtagagaa
gtgggcataaagctggccaacaacgtgcccattcagcccggccccgttgaggtaaagaaa
acagaatacgaggcatcagggggcttggagatatttctcgaggccgtcggccccgatgat
actctatacgcaatactgcggctgagaattccaaatagaccgcacaggcctgagctgtac
aaggcggcgttagtgagagagctacacgtctacggccccgccgtgccagtggggaagcag
ggcatttggtggcaacactcaggcatgggcagagagctcatgagactggcggaggaaata
gctggggaattcggcgcgttgaaaatcgccgttatctccggagtgggggtgagggagtac
taccgcaagcttggctacgagaggtgcggcccctacatgtgcaagcccctgggggcgccc
ctaggcgttgccgacgacgggctagtggcgggctga

DBGET integrated database retrieval system