KEGG   Pyrobaculum aerophilum: PAE0988Help
Entry
PAE0988           CDS       T00073                                 

Definition
(GenBank) histidinol dehydrogenase (hisD)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00340  Histidine metabolism
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PAE0988
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PAE0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAL63179
UniProt: Q8ZY17
Position
complement(577655..578761)
Genome map
AA seq 368 aa AA seqDB search
MRGFPREVLESVWKIVDDVQSGGLKAALEYSKRLDGVAPEPHLVTPRQGGDPEVVSAALA
AAKSLEALYSRISPPAAVDFYGGILRQILWKPVRRAALYVPARYISTLVMLAVPARLAGV
EEVYVVTPPRGVSEELLAVAKELGVKAVLALGGPHGLAYAVFHMGVDVVAGPGGLYVQAA
KYILSQYVGIDGIEGPTELVIYAEGVPPEVAVRGALAQLEHGPTSFAYLLSPDGELLKKA
EELYVRERTSSMGPLKVKKVGGIDEAVSFIDEIAPEHLEVWGRREVAYRVRNVGAVSVNM
PSPYLDYVAGISHVLPTGGTARWRGVITPLAFMKPIGIAEAVGELTLREAARKLAEYEGF
KYHGEALR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagggggttcccccgggaggtgttggagtccgtgtggaaaatcgtcgacgacgtgcaa
agcggcgggctaaaagcggcgctggagtattcaaagagacttgacggcgtggcgcccgag
cctcatttagtaactccgaggcagggaggcgaccccgaggttgtctccgcggcgctagcc
gcggctaagtccctggaggccctctacagccggatatctccccctgccgccgtggatttc
tacggcgggattttgaggcaaattttgtggaagcctgtgaggcgggcggctctttacgtg
ccggcgcgttatatatctacgctcgtaatgctggcagtgccggctaggctggccggagtg
gaggaggtttacgtagtgacgccgccgaggggcgtgtccgaggagctactagccgtggcc
aaggagttgggagttaaagcggttttagccctgggaggcccacacgggctggcgtacgcg
gttttccacatgggggttgacgtagtggcagggcccggagggctgtacgtacaggcggcg
aagtacatactctctcaatacgttggaattgacggcattgaggggcccacagagctcgtt
atatacgccgagggcgttccgccagaggtggccgttcggggggcgcttgcccaattagag
cacgggccgacttccttcgcctatttgttgtcccccgacggcgagttgttaaaaaaggcg
gaggagctgtacgtaagggagaggacttcctccatgggcccgcttaaagttaaaaaagtc
ggcggcattgacgaggcggttagctttattgacgaaatcgcgccggagcatttagaagtg
tgggggaggagggaggttgcctacagagtgagaaacgtaggcgctgtgtctgtcaacatg
ccgagcccctacttggactacgtcgccggtattagccacgtgttgcccacggggggtaca
gccaggtggcgcggcgtgataacccccctcgcctttatgaagccaattggaattgctgag
gccgtaggggagttaacgctgcgggaggccgctagaaaactcgccgagtatgagggcttt
aaataccacggagaggccttgcgatga

DBGET integrated database retrieval system