KEGG   Pyrobaculum aerophilum: PAE1029Help
Entry
PAE1029           CDS       T00073                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE1029
   01230 Biosynthesis of amino acids
    PAE1029
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE1029
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PAE1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601692..603560
Genome map
AA seq 622 aa AA seqDB search
MIILEIDVERRAVSRREIDASGPVEAALAIHKERETWRLDPLSPQVPVVFGMGPFVGGRL
YGVHRLIFIFKSPQTGTLHVSALGGAAYKAMGMGAQAVSIVGRAPTPTAIFISQGYVKFA
EVKPGDAYETINSLYREFKNFFLENDARALVVGPAAYTTYNGAVVSVDVDVRKGEFKLGA
EDFAARGGPGTALAQGHNVAAIVVGGPKRPHFEKVTDAEAINQIFNKSFGRPYLDVLNEK
TVKYRFDQKLRTGGTFGVNYPHYRDLLPLFGYKSIYMSREERVKHADLILQLFWKPFQEE
VFEKGRSWYNCGEPCPVVCKKVWRGKKVDYESFHAMGPFIGNYLFQEAVPLVDKVDKLGL
DAIEMGHLVAWLFDAVHAGLLKPEELGLDDTPAFDPARFDPHGDSKKNARLAGHLLDNFV
NNSTEVLALVARQGIRKAARELEKRFSDRVKAAGVRFRDLAVYAAFGTEGYMTPNFYWAP
GLIAPMYIQGRYWTNYNPTFMLPEDFAKSSYDRAVAEAYIDNAGICRFHRGWAEPVLAEL
YALVGVKPPTSQLYRDLAYYAKLAGAEPMPWESKRARDLVSTLARELGAKDWKFEDYDDY
YEWWVRFFSTVNRLIFATPTTV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgataatacttgagatagacgtggagaggagggctgtctccaggcgggagatagacgcg
tcgggccccgtggaagctgcgctggctattcacaaagagcgggagacctggcgcctagac
ccactgtcgccgcaagtcccagtggtattcggcatgggtcccttcgttggggggaggtta
tacggcgtgcacaggctgatatttattttcaaaagcccccagacgggcacgttgcacgtc
tcggcgctagggggggccgcctataaagccatgggcatgggcgcacaagccgtgtcaata
gtgggtagagcccccacgcctactgccatttttatttcacaaggctatgtaaaattcgca
gaagtgaagccgggcgacgcctacgagactataaacagcttgtacagagagtttaaaaac
ttcttcctcgaaaacgacgccagggcgctagtagtaggcccggcggcctatactacatac
aacggggctgtggtctctgtagatgttgacgtgagaaaaggggaatttaaactcggcgct
gaggacttcgccgcaagaggcgggccgggcaccgccctcgcccaggggcataacgtggcg
gcaatagtagtgggggggccgaagaggccccactttgagaaagtgaccgacgccgaggcg
ataaaccaaatctttaataagagctttggcaggccctaccttgacgtattaaacgagaag
actgtaaagtatagatttgaccaaaagctaagaaccggcgggactttcggcgttaactac
ccgcactaccgcgacttgctccccctcttcggctacaagtcaatatacatgagcagagag
gagagggtgaaacacgccgacttaatactacaactgttctggaagccgtttcaagaggag
gtgtttgaaaagggcaggagttggtacaactgcggagagccctgcccggtggtgtgtaaa
aaagtatggcgcggcaaaaaggtggattacgaatctttccacgccatgggccccttcata
gggaattacttattccaagaggcagtgccgctggtggacaaagtggacaagctcggcctc
gacgccatagagatgggccatttagtcgcgtggctattcgacgcagtacacgccggcctt
ttaaaacccgaggagctggggctggacgacacgccggccttcgacccagcgcgttttgat
ccccacggcgattcgaagaaaaacgccaggctggcagggcatttgctcgacaattttgta
aacaactccactgaggtactggcgctagtcgcccgccagggcattagaaaggcggcgcgg
gagttggaaaagcggttttcagacagagtaaaagccgccggcgttaggttcagagacttg
gccgtatacgccgcgtttggcacagaggggtacatgactcccaacttttactgggccccc
gggctgattgcgcctatgtacatccaggggaggtactggacaaattacaaccccaccttc
atgctcccggaggacttcgccaaatcttcatacgacagggccgtggctgaggcctatata
gacaacgcggggatatgcagattccacagaggctgggcagagcccgtactggcggagctc
tatgcgctagtaggcgtgaagccgcccacgtcacagctctaccgagatcttgcttattac
gccaaactggcaggcgcggagccaatgccctgggagagcaaaagggcacgagacctagtc
tcaaccctggccagagagctaggcgccaaagactggaaatttgaagactacgacgactac
tacgagtggtgggttaggttcttttctacagtaaatcggttgatctttgcaacgcccacg
acggtctag

DBGET integrated database retrieval system