KEGG   Pyrobaculum aerophilum: PAE1040Help
Entry
PAE1040           CDS       T00073                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase gamma subunit (porG)
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00020  Citrate cycle (TCA cycle)
pai00620  Pyruvate metabolism
pai00633  Nitrotoluene degradation
pai00640  Propanoate metabolism
pai00650  Butanoate metabolism
pai00680  Methane metabolism
pai00720  Carbon fixation pathways in prokaryotes
pai01100  Metabolic pathways
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01200  Carbon metabolism
Module
pai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE1040
   00020 Citrate cycle (TCA cycle)
    PAE1040
   00620 Pyruvate metabolism
    PAE1040
   00640 Propanoate metabolism
    PAE1040
   00650 Butanoate metabolism
    PAE1040
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE1040
   00680 Methane metabolism
    PAE1040
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE1040
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AAL63219
UniProt: Q8ZXX7
Position
609092..609619
Genome map
AA seq 175 aa AA seqDB search
MGLLEVRFHGRGGQGMVTAAQVLAAAAILEGKYAQAFPEFGPERRGAPVKSYLRISDRPI
YIREPILRPDVIVVADQSLFKAENPFEGAKENTILVVNGAYKAPIKTYYVDATSLAMKVL
GRPIVNTAIIGAVVKATGLVSLSSVAEALKKYFSGRLYDLNLKLVEMAYQETVGL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggccttttagaagtgaggtttcacggccgcggggggcagggcatggtcacagcggcg
caagtattggcggcagcggctattttagaggggaagtacgcacaagctttccccgagttc
ggccccgagcgccggggagctcccgtcaagtcgtacttgcgcatatcagacaggccgatt
tacatcagagagcccatcttgcgcccagacgtaatagtagtcgcagaccagtctctgttc
aaggcggagaatccctttgagggtgcgaaggaaaacaccatcctagtggtaaacggcgca
tacaaggcgcccataaagacatattatgtagacgcaacttctctcgcgatgaaagtattg
ggcaggcctatagtaaacacggcgataatcggcgccgtggtgaaggcaacgggcctagtg
tcgctgtcctcagtagccgaggctttaaagaaatatttctccgggaggctgtacgacttg
aatttaaaacttgtggaaatggcctatcaagagacagtggggctatga

DBGET integrated database retrieval system