KEGG   Pyrobaculum aerophilum: PAE1041Help
Entry
PAE1041           CDS       T00073                                 

Definition
pyruvate ferredoxin oxidoreductase subunit delta (porD)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE1041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE1041
   00020 Citrate cycle (TCA cycle)
    PAE1041
   00620 Pyruvate metabolism
    PAE1041
   00640 Propanoate metabolism
    PAE1041
   00650 Butanoate metabolism
    PAE1041
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE1041
   00680 Methane metabolism
    PAE1041
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE1041
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609616..609924
Genome map
AA seq 102 aa AA seqDB search
MTLPKATELPIGAVITQPGSTRRNLTAGWRTLKPVIHDDRCIRCQLCWLYCPEGTIAEIK
GVFKVGNKTYDVKYEVIYDYCKGCGICANECPTKAIEMVPEP
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgccaaaggcgactgaattaccaataggcgcggtgattacgcagccaggttcc
acgcggcgcaatctaacagctggctggaggacgctcaagccggtgatacacgacgacaga
tgtataagatgccagctatgttggctctactgccccgaggggacaatagcggaaataaaa
ggcgtcttcaaggtaggtaataagacttacgacgtaaaatacgaggttatatacgactac
tgcaagggttgcggcatatgcgcaaatgaatgtccaactaaggctatagagatggtgccg
gaaccatga

DBGET integrated database retrieval system