KEGG   Pyrobaculum aerophilum: PAE1209Help
Entry
PAE1209           CDS       T00073                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pai  Pyrobaculum aerophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAE1209
Enzymes [BR:pai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAE1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708014..709420
Genome map
AA seq 468 aa AA seqDB search
MLRGAGVLLHITSLPGGCFVGDLGPEAYKFADSLAYAEQTYWQTLPINHTVPEYENSPYS
AVSSYAGDPVLISLELMKRDGLIDSVPQCPPAERADYIKAWEVKRKALEKALKRAGRLSD
YRHFKDVTPWLDDYAYYMAMRERFGPWPVWPKEEPPPASLELYKFAQFVFWTQWERFKEY
VNSLGIFLIGDLPFYPSLDSVDVWRNKKYFKVGEDGRPLYVAGVPPDYFSATGQLWGNPV
YNWEALERDGFKWWVNRLKHAVTVFDYVRLDHFRGYVAYWEVPGGETTAVRGRWAPSPGR
RLFEAAAAAVDLGRLIAEDLGYITPEVEALREELGLPGMRVLQFAWDGNPANPHKPHNHV
KNAVVYTGTHDNNTAVGWYKEEATARARREFKKYSNCAGEVHWCFIKLAHMSVANVAIVP
VQDLLGLGSEARMNRPGTVGGNWKWRLGAQPEPRVWKRLRDVTRTYGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaggcgccggcgtattattgcacataacctcgctgccagggggctgttttgtc
ggcgacttggggccggaggcgtataaattcgcagacagcttggcatacgcagagcagacc
tactggcagacactgcccataaaccacacagtccccgagtacgagaactccccctacagc
gccgtgtctagctacgccggagaccccgttttaataagccttgagttaatgaagcgcgac
ggcttaatagacagcgttccccagtgcccgcccgcggagagagccgattacataaaggcc
tgggaggtaaagagaaaggcgctggaaaaggctctgaagagggccgggaggctgagcgac
taccgccattttaaagacgtcacgccttggcttgacgactacgcctattacatggccatg
agggagaggttcgggccgtggcctgtatggcctaaggaggagccgcctcccgcgtcactg
gaattatataaattcgcccagttcgtcttctggacgcagtgggagaggtttaaagaatat
gtaaacagcctgggcattttcctcatcggcgacctccccttttacccaagtctcgatagc
gtagatgtgtggaggaacaaaaagtattttaaagtgggagaagacgggaggccgctgtac
gtggctggggtacccccagattatttctcggccactggacagctgtggggaaaccccgtt
tacaactgggaggcgctggaaagagacggctttaagtggtgggttaataggcttaaacac
gcagtgacagtttttgactacgtcaggctggaccacttcaggggatacgtggcgtattgg
gaagtgccggggggcgagacgacggcagttagggggaggtgggcgccgtcccccgggagg
aggctgtttgaagcagccgccgcggctgtagacctcggcagattaatcgccgaggactta
ggctatataaccccggaggtggaggcgttgcgagaagaattggggctgccgggaatgcgg
gttttacaattcgcctgggacggaaacccagccaatccccacaagccgcacaaccacgtg
aaaaacgccgtggtgtacacgggcactcacgacaataatacagcagtcggctggtataaa
gaagaggccactgcccgggccaggcgggagtttaaaaagtactcaaattgcgccggagaa
gtacactggtgttttataaaactggcacacatgtccgtggcaaacgtggcaatagtcccc
gtgcaagacctactgggactgggttcagaggccaggatgaataggccaggcactgtgggg
ggcaactggaagtggaggcttggggcccagccggagccgcgcgtttggaagaggcttaga
gacgtcacgaggacttatggcagataa

DBGET integrated database retrieval system