KEGG   Pyrobaculum aerophilum: PAE1287Help
Entry
PAE1287           CDS       T00073                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pai  Pyrobaculum aerophilum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE1287
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAE1287
   00630 Glyoxylate and dicarboxylate metabolism
    PAE1287
Enzymes [BR:pai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PAE1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758297..760738
Genome map
AA seq 813 aa AA seqDB search
MIEINPLVVKNYGDLLGVKTVNNRQVSVEGLIEELVREFRDEINRVIRARREWLNDKRPV
RVKGAFPHWEEKFVDADGNVRTFREIVQGLIDNLLDRDSPLRWGLNWNTPVPDDLHPLKN
PGLEITGPWYPMSRAIHQINADVASMMEDEEDASPAWYIPRGSGRAVAAVWEARRVVNRV
LRGEVPQPYYEGGKEYRIKKPRDKWPTLIHRVPGLHILDFDIRVDGKPAPAIITSIVIYT
VNNYDLLKRAGSGVYFYIPKVQTPDEALVIEKILRRVEDRLGLKRGELKIAMLYEEARAG
LYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPIMMAYQKWNAL
LCLMAGLDRGGRLNAAPVGGMAAVMLYRPDDPYQRNRFNARALRAIWLDKLRERLIGLIF
LTEEPVRKVTLNDILKGRVKGRLFDLFRQSWVATPEESYVKAGNEPLRASLEELQQLINR
PVKFVEVDGVKIPAVDSGLTEQERQLFIKLGLIDEDGNITPWVIRPDMLDTPEKLLNNPE
LWGGKDLWSALFEPPKGDITAEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMNDL
ATYRIFSTWLWTLLRHKAVITKDGAFKGPARTSLGVIPAEDRVKIPAGTPFTEELFDKLW
DLHMEWTLAFYDDLDIIAAERILTRFTDRVKRAIAEAYRAGPFRYQSPRETAKKIAEVIT
EEELEKAVVENQPRFDRSFAPVIMEILKTKLKSPMYLQHSGRLIMALAPLPDEERDLALK
ALFTPREEVERLVREGRLRPQVLELYDYIHDNR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
gtgattgagataaacccgcttgtggtgaaaaactacggtgacttattaggcgttaagact
gtaaataaccgacaggtctccgttgaggggctaatagaggagttagtgagggagtttcgg
gatgaaattaatcgcgttattagggcgaggagggagtggctaaacgacaagaggccggtt
agagttaaaggggcgtttccccactgggaggagaaattcgtcgacgcggacggcaacgtg
agaacttttagggaaatagtccaggggctaattgacaacctcctcgaccgggacagcccc
ttgaggtggggtctaaactggaacacgccagtgccagacgacctccatccgttgaaaaac
ccaggccttgaaatcacagggccctggtatccaatgagcagggcaattcatcaaatcaac
gctgacgtggcgtcaatgatggaggacgaggaagacgcctctcctgcctggtatatccca
cgcggctctggcagagccgtggcggcggtgtgggaggcccggcgcgtggtcaacagagtg
cttaggggggaggtcccccagccttattacgaaggggggaaggagtatagaattaaaaag
ccgagggacaagtggcccacgcttatacaccgagtccccgggctccacatacttgacttc
gatattagagttgacggcaagccggcccccgccataataacctctattgtgatatacact
gtaaataactacgacctcctcaagagggcgggctctggcgtttacttctacatccccaag
gtgcagactccggacgaggccctggtaattgaaaaaatacttagaagagtagaggacagg
ctggggcttaagagaggggagcttaaaattgcaatgctttacgaagaggccagggccggc
ctctacctgcccgttatcttctggatatggagggagaggctagtcaagagcaacaacggc
cgttgggactacttaggctcgttaattgaaatgtggaaagacgaggccgtgtacccagat
ccgcagaacatcactatgactcaccccataatgatggcttatcaaaagtggaacgcgctt
ttatgcctcatggcgggcctggacagaggggggaggctaaacgccgccccagtggggggg
atggccgccgttatgttgtacagacccgacgacccttaccagcgcaatcgcttcaacgct
agagccctcagagccatatggctggataaattaagagagaggctcattgggctgatattc
ctcacagaagagcctgtgagaaaagtaactcttaacgacatcctcaaggggagggtcaag
gggaggcttttcgacttatttagacaaagctgggtggcaacgcccgaggagtcttacgtc
aaggccggaaacgagccgctgagggctagcctagaggagttgcaacagttaattaaccgc
cctgtgaaattcgttgaagtcgacggcgtgaaaatacccgcagtggacagcgggctgaca
gaacaagagaggcagctctttattaaactggggctaattgacgaggacggcaacataacg
ccgtgggtaataaggccggacatgttagacacgccggagaaattactaaataacccagag
ctttggggcgggaaggacctctggtcggcgttattcgagccgcctaaaggcgacataacg
gcggagcacatacaacacgctttttacatggcggctaattacggcttccagctactcaac
ggcaacttggccgctgcaatagacgactacgagctggggcagcgctttatgaacgactta
gccacataccgtatattttccacatggctgtggactctgctgaggcacaaggcagttata
actaaagacggcgctttcaaggggcccgcgaggacgtcgctaggcgtcatcccggccgag
gacagagtgaaaatacccgccggcactcccttcacagaggagcttttcgataagctatgg
gatctccacatggagtggacgctggccttttacgacgacttagacataattgccgccgag
aggattttaactaggtttacagacagagtgaaaagggccatcgccgaggcctacagggcg
ggcccgtttagataccaatcgcccagagagactgctaagaaaatcgcggaagttattact
gaggaggagttggaaaaggcagtggtggagaaccagccccgttttgacaggtccttcgcg
ccagtcatcatggagattctaaaaacaaagctgaagtcgccaatgtatttacaacacagc
ggccgtctcattatggcgttggcgcctctgccagacgaggagagagatctcgcgttaaaa
gccctatttacgccgagagaagaggtggagaggctagtcagagagggaaggctaaggccc
caagtcctagagttatacgactacatacacgacaatagataa

DBGET integrated database retrieval system