KEGG   Pyrobaculum aerophilum: PAE1385Help
Entry
PAE1385           CDS       T00073                                 

Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pai  Pyrobaculum aerophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAE1385
Enzymes [BR:pai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PAE1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825595..826683
Genome map
AA seq 362 aa AA seqDB search
MDDFVQLLKKLSEARGPSGFEDEVREVVIKEMEPYVDEVVVDRWGNVIGVKKGASNYRAM
VAAHIDEIGLIIDHIEKEGFLRFRPIGGWNEITLVGQRVWVRASDGRWIRGVIGSTPPHV
TPSGKEREAPEIKDMFIDIGASSKEEAEKIGVVIGSIAVLDREFAVLNGKVVTGKAFDDR
VGVAVMLYTLRQLRDLPVTLYAVATVQEEVGLRGAQIAAEKINPHYAIALDTTIAADVPG
VGERLHITKIGKGPAIKVLDGGRGGLFIAHPGLRDHIVKLAREAGIPYQLEVLYGGTTDA
MAIAFRREGIPAATISIPTRYVHSPVEVLNVEDAVNASRLLKIVLERTTPDIVDKFLDKK
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgactttgtacaacttttaaaaaaactctcagaggcgaggggcccgtccggcttt
gaagacgaggtgagagaggttgtcataaaggagatggagccctatgttgacgaggtggtt
gtggacaggtggggaaatgtcatcggcgttaagaagggcgcctctaattacagggctatg
gtcgctgcgcatattgacgagattggcctaataattgaccacattgagaaagagggattt
ctcaggtttaggccaataggggggtggaacgaaattactttagtcgggcagagggtttgg
gtgagggcatccgacggcaggtggatcagaggcgtgattggctcaacgccgcctcacgta
accccctctggtaaggagagggaggcccccgagataaaagacatgtttattgacataggc
gcctctagtaaagaggaggctgaaaaaatcggcgttgtgataggttctattgctgtttta
gaccgagagttcgccgtattaaacggcaaagtcgtgacgggaaaggcctttgacgacaga
gtgggagtagccgtaatgttatacacgctaagacagctaagggacttgcccgtgactctc
tacgccgtcgccactgtacaagaagaggtggggctgaggggggcgcagatagccgctgag
aaaatcaacccgcattacgccatagctttagataccactattgccgcagacgtccccggg
gtgggggagcgtttgcatattactaaaatcggcaaaggtccggccataaaggtattagac
ggggggcgcggcggcctttttatagcccacccaggcctcagagatcacattgtaaaattg
gcgagggaggcgggaataccctaccagcttgaggttttatacggcggcactactgacgcc
atggcaatagcgtttcggagagagggtattcccgcggccacaatttccatccccacacgc
tatgtacactccccagtggaagtgctcaacgtggaagacgcagtaaacgcatctaggctt
ttaaaaatagtgctggagagaactacgcctgatattgtcgataagttcctcgacaagaaa
gttaagtag

DBGET integrated database retrieval system