KEGG   Pyrobaculum aerophilum: PAE1385Help
Entry
PAE1385           CDS       T00073                                 

Definition
(GenBank) aminopeptidase from family M42
Organism
pai  Pyrobaculum aerophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
825595..826683
Genome map
AA seq 362 aa AA seqDB search
MDDFVQLLKKLSEARGPSGFEDEVREVVIKEMEPYVDEVVVDRWGNVIGVKKGASNYRAM
VAAHIDEIGLIIDHIEKEGFLRFRPIGGWNEITLVGQRVWVRASDGRWIRGVIGSTPPHV
TPSGKEREAPEIKDMFIDIGASSKEEAEKIGVVIGSIAVLDREFAVLNGKVVTGKAFDDR
VGVAVMLYTLRQLRDLPVTLYAVATVQEEVGLRGAQIAAEKINPHYAIALDTTIAADVPG
VGERLHITKIGKGPAIKVLDGGRGGLFIAHPGLRDHIVKLAREAGIPYQLEVLYGGTTDA
MAIAFRREGIPAATISIPTRYVHSPVEVLNVEDAVNASRLLKIVLERTTPDIVDKFLDKK
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgactttgtacaacttttaaaaaaactctcagaggcgaggggcccgtccggcttt
gaagacgaggtgagagaggttgtcataaaggagatggagccctatgttgacgaggtggtt
gtggacaggtggggaaatgtcatcggcgttaagaagggcgcctctaattacagggctatg
gtcgctgcgcatattgacgagattggcctaataattgaccacattgagaaagagggattt
ctcaggtttaggccaataggggggtggaacgaaattactttagtcgggcagagggtttgg
gtgagggcatccgacggcaggtggatcagaggcgtgattggctcaacgccgcctcacgta
accccctctggtaaggagagggaggcccccgagataaaagacatgtttattgacataggc
gcctctagtaaagaggaggctgaaaaaatcggcgttgtgataggttctattgctgtttta
gaccgagagttcgccgtattaaacggcaaagtcgtgacgggaaaggcctttgacgacaga
gtgggagtagccgtaatgttatacacgctaagacagctaagggacttgcccgtgactctc
tacgccgtcgccactgtacaagaagaggtggggctgaggggggcgcagatagccgctgag
aaaatcaacccgcattacgccatagctttagataccactattgccgcagacgtccccggg
gtgggggagcgtttgcatattactaaaatcggcaaaggtccggccataaaggtattagac
ggggggcgcggcggcctttttatagcccacccaggcctcagagatcacattgtaaaattg
gcgagggaggcgggaataccctaccagcttgaggttttatacggcggcactactgacgcc
atggcaatagcgtttcggagagagggtattcccgcggccacaatttccatccccacacgc
tatgtacactccccagtggaagtgctcaacgtggaagacgcagtaaacgcatctaggctt
ttaaaaatagtgctggagagaactacgcctgatattgtcgataagttcctcgacaagaaa
gttaagtag

DBGET integrated database retrieval system