KEGG   Pyrobaculum aerophilum: PAE1501Help
Entry
PAE1501           CDS       T00073                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE1501
   01230 Biosynthesis of amino acids
    PAE1501
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE1501
   00051 Fructose and mannose metabolism
    PAE1501
   00562 Inositol phosphate metabolism
    PAE1501
Enzymes [BR:pai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAE1501
Exosome [BR:pai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAE1501
  Exosomal proteins of bladder cancer cells
   PAE1501
  Exosomal proteins of melanoma cells
   PAE1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879522..880205
Genome map
AA seq 227 aa AA seqDB search
MKFPILIINFKAYYEASGRRAVHIAKAAERVAKELGVNIAVAPNHLELALVAQSVEIPVY
AQGADVESPGAHTAHVAVDNIKEAGASGLILNHSEAPLRLNEIAKLTARAKAAGLDVVIC
APDPRTSLAAAALSPHAVAVEPPELIGTGRAVSKYKPETVVETVQLVGRHFPDVAVITGA
GIESGEDVEAALKLGTRGVLLASAAVKAKDPYLKILELAKPLAAGPP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcccaattctaatcattaacttcaaggcgtattatgaggcgtctggccgccgc
gcagttcatatagccaaagccgccgagagagttgcaaaagaactcggcgtgaatatagcc
gtggcgcctaaccacctcgaactggcgctagtggcgcagtctgtggaaatacccgtatac
gcccaaggtgccgacgtcgaatctccaggcgcgcacacggcacacgtcgccgtcgacaac
attaaagaggcaggcgcgtcgggccttattttaaaccacagcgaggcgcccctcaggcta
aacgaaatagctaaactaactgccagggctaaagccgctgggcttgacgtagttatctgc
gcccccgatccgaggaccagccttgccgccgccgccctaagcccgcatgcagtcgccgtt
gagccccccgagctgatcgggaccgggagggctgtctccaagtataaacccgagactgtt
gtggaaactgtccagctagtggggaggcacttccctgacgtcgccgtaataactggggcg
ggtattgagagcggagaggacgttgaagccgcgcttaaactcggcacgaggggagtgttg
ctggcaagcgcagccgtgaaggcaaaagacccatatcttaagatcttagaattggcgaaa
ccgctcgcggcggggccgccttaa

DBGET integrated database retrieval system