KEGG   Pyrobaculum aerophilum: PAE1921Help
Entry
PAE1921           CDS       T00073                                 

Definition
putative alcohol dehydrogenase
Orthology
K15020  
acryloyl-coenzyme A reductase [EC:1.3.1.84]
Organism
pai  Pyrobaculum aerophilum
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE1921
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE1921
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.84  acrylyl-CoA reductase (NADPH)
     PAE1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130976..1131968
Genome map
AA seq 330 aa AA seqDB search
MKAYVLRNFKELVLSEVDRPKPGPGRAVVKIVAAGVCYRDFLGWQGFQRVKLPLIAGHEF
AGVVEEVGEGVSEFKPGDAVAGMMYEYCGECEYCKSGREYLCKNRKIYGEDLPGAFAEYI
SVDQKSLVKIPPGVSFEAASYAACVLSTVVRGARKIGVSPGRQILVTGAGGGVGVHAVQV
VKAYGARVIAVTSPSKAEYVAKFADYVITNKAFSDEVKKLGGADGAIEAVGGPTLEQTLR
SLNWGAKVALIGNVDPQPAPIPLGILILKEIDVLPVIQGSKADLQEALRLLASGAVKPVY
TVHGFSDIPRLLEETPKASHVGRRVVKMST
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgtacgtattgagaaatttcaaagaactcgtcttgtctgaagtcgataggccg
aagccggggcctggaagggcggtggtgaaaatcgtcgcggctggcgtttgttatagagat
ttccttgggtggcagggctttcagcgagtaaaactccccctaattgctggccacgaattc
gccggcgtggtggaggaagttggcgaaggagtgtcggagtttaaaccgggcgatgccgtt
gcgggcatgatgtatgaatattgcggggagtgcgagtattgtaaatcgggtagggagtat
ttatgtaaaaacaggaaaatctacggcgaggatctccccggggcctttgccgaatacatc
tcagtagatcagaagtctcttgtgaaaatcccgcctggcgtgtccttcgaggcggcctct
tacgccgcgtgcgtcttgtccacagtggtgaggggggctaggaaaatcggcgtctccccc
ggccgccaaattctcgtcactggcgcgggcggcggcgtgggggtacacgcagtacaagtg
gtcaaggcctacggggccagggtaatagccgtgacttctccatccaaggctgaatacgtg
gctaaattcgcagattatgtaattaccaacaaggcgttttccgatgaggttaaaaaattg
ggcggcgccgacggcgcaatagaagcagtgggagggcccacattagaacagacgcttagg
tcgttgaactggggggccaaggtggcgttaattggcaatgtagacccccagcctgccccc
atccccctcggcattttaatacttaaggaaattgacgtgctcccagtcatacaggggtct
aaggctgacttacaagaggcgttgcggcttttggcctccggcgccgtaaagcccgtctac
acagtccacggcttttctgatattccaaggcttttagaagagacgcctaaagcgtctcac
gttgggaggcgggtggttaagatgagcacttaa

DBGET integrated database retrieval system