KEGG   Pyrobaculum aerophilum: PAE2051Help
Entry
PAE2051           CDS       T00073                                 

Definition
(GenBank) alcohol dehydrogenase (Zinc)
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00071  Fatty acid degradation
pai00350  Tyrosine metabolism
pai00625  Chloroalkane and chloroalkene degradation
pai00626  Naphthalene degradation
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE2051
  Lipid metabolism
   00071 Fatty acid degradation
    PAE2051
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAE2051
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAE2051
   00626 Naphthalene degradation
    PAE2051
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAE2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Methyltransf_31 ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AAL63909
UniProt: Q8ZVZ5
Position
complement(1208872..1209948)
Genome map
AA seq 358 aa AA seqDB search
MTGIRKTHKAAFFYEIAGPFKIDEVPTPEEVPPYGLLVKTRSVGICHSDLHLWQGDYKSI
GLPKSLPWIVGHEIVGTIAKKGSLVPESLREGTPVLVYAWQPADENDEIVAEGYTQLASR
RRRYAFDIEGGLQEYIVVPHYKYVIPLEGFEEIESIAPLGCAGLTTYNAVKKIRKYIRPD
DYILIVGLGGLGIYAVQWAKVLLPEANIIAVDIREEALQFASKIVRDVVYTKVNANTIEI
LNEITKGRGVRAVIDLVSNNNTVPIYSKILTTKGVYNLVGLMGHEVTIPTQILIRKEIVI
ITTYTGSLADQINVIKLAKKINYKEVISERFKFTEEDVNKAFNKLKEGKILGRGIIVF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaataagaaagacccataaagcggctttcttttacgaaatagcaggtccgttt
aaaatagacgaagtgcccacacccgaagaggtgccgccttacgggctactagtgaagaca
agatctgtgggcatatgtcattctgatctacacctttggcaaggcgattataagtcaata
ggtcttcctaaaagtttgccgtggattgtaggacatgagatagttggtactattgctaaa
aagggttcactagttccagagtctctgagagaaggcacaccagtattggtttatgcttgg
caacctgcggatgaaaacgatgaaatagttgcagaagggtatacacaacttgcgtcaagg
agacgtagatatgcatttgacatagaaggaggtctccaagagtatatagtggttcctcac
tataagtatgtaataccattagagggttttgaagaaatagaaagtattgcaccacttggt
tgcgctggactaactacatataacgccgttaagaaaatacggaagtatataaggcctgat
gattatattttaatagtaggacttggaggtttaggtatatacgcagtgcaatgggccaag
gtactcttgccagaggccaatatcatcgcggtagacattagagaagaggctctacagttt
gcatcaaagatcgtacgagatgtagtatatactaaggtaaacgcgaacactattgaaatt
ctaaatgagataaccaaggggagaggtgttagagcagtaatagacctagtttcaaacaat
aatactgtgccaatatacagcaaaatacttacaacaaaaggagtttataaccttgtcggc
ttaatgggacatgaagtaacaatacctacgcaaatacttattagaaaagaaatagttata
ataactacatatacaggatcgttagctgatcaaattaatgtaattaagctagcgaagaaa
attaattacaaagaggtaatatcagaaagatttaaatttacagaagaagatgtaaataaa
gcttttaataaattaaaagaaggaaaaatcctaggaagaggaatcattgttttctaa

DBGET integrated database retrieval system