KEGG   Pyrobaculum aerophilum: PAE2158Help
Entry
PAE2158           CDS       T00073                                 

Definition
(GenBank) fuculose-1-phosphate aldolase (fucA)
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00051  Fructose and mannose metabolism
pai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAE2158
Enzymes [BR:pai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PAE2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Peptidase_C92 Peptidase_M19
Motif
Other DBs
NCBI-ProteinID: AAL63990
UniProt: Q8ZVR6
Position
complement(1273007..1273594)
Genome map
AA seq 195 aa AA seqDB search
MSIVDEFLKYTHLLYNRGHLTLLSGNVSVVVGELLIVTPTSYPKPFLEPGDLVWINFNGE
VVRGSRKPTSEWRMHVAIYKRRSDVRAVVHTHDVLPVLLADRIDASLLSEAEAYLGSGIS
IVPYLPPGTAELAEAVAAALEKANVAILKRHGVVAVGRDLAEAVNRIEVVADLAKATFYK
TLMDIVELWSVKKGV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagtagacgaattcctcaagtatacacacttgctgtataacagaggccattta
actctcctctctggaaacgtgtctgtggtagttggcgagctccttatagtcaccccgacc
tcatacccaaagccctttttagagcccggcgacttggtgtggatcaactttaacggagag
gtagtaagaggtagccgtaagccaacgagcgaatggcgcatgcatgttgctatatacaag
aggaggagcgacgtgagggcagtagtccacacccacgacgtgttgcctgttctgctcgcc
gataggatagacgcctccctcctctcggaggctgaggcgtatttaggctccggcatatct
atagtgccttatctcccgcctggcactgcggagcttgcagaggcagtcgcggcggcgctt
gaaaaagccaatgtggctattttaaaacgccacggcgtggttgccgtgggcagagacttg
gcagaggccgttaacagaatagaagtagttgccgatttagccaaggccacgttttataaa
acgttaatggatattgtagagctatggagtgtaaagaaaggcgtttaa

DBGET integrated database retrieval system