KEGG   Pyrobaculum aerophilum: PAE2158Help
Entry
PAE2158           CDS       T00073                                 

Definition
fuculose-1-phosphate aldolase (fucA)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pai  Pyrobaculum aerophilum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pai00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273007..1273594)
Genome map
AA seq 195 aa AA seqDB search
MSIVDEFLKYTHLLYNRGHLTLLSGNVSVVVGELLIVTPTSYPKPFLEPGDLVWINFNGE
VVRGSRKPTSEWRMHVAIYKRRSDVRAVVHTHDVLPVLLADRIDASLLSEAEAYLGSGIS
IVPYLPPGTAELAEAVAAALEKANVAILKRHGVVAVGRDLAEAVNRIEVVADLAKATFYK
TLMDIVELWSVKKGV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagtagacgaattcctcaagtatacacacttgctgtataacagaggccattta
actctcctctctggaaacgtgtctgtggtagttggcgagctccttatagtcaccccgacc
tcatacccaaagccctttttagagcccggcgacttggtgtggatcaactttaacggagag
gtagtaagaggtagccgtaagccaacgagcgaatggcgcatgcatgttgctatatacaag
aggaggagcgacgtgagggcagtagtccacacccacgacgtgttgcctgttctgctcgcc
gataggatagacgcctccctcctctcggaggctgaggcgtatttaggctccggcatatct
atagtgccttatctcccgcctggcactgcggagcttgcagaggcagtcgcggcggcgctt
gaaaaagccaatgtggctattttaaaacgccacggcgtggttgccgtgggcagagacttg
gcagaggccgttaacagaatagaagtagttgccgatttagccaaggccacgttttataaa
acgttaatggatattgtagagctatggagtgtaaagaaaggcgtttaa

DBGET integrated database retrieval system