KEGG   Pyrobaculum aerophilum: PAE2158Help
Entry
PAE2158           CDS       T00073                                 

Definition
fuculose-1-phosphate aldolase (fucA)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pai  Pyrobaculum aerophilum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAE2158
Enzymes [BR:pai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PAE2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273007..1273594)
Genome map
AA seq 195 aa AA seqDB search
MSIVDEFLKYTHLLYNRGHLTLLSGNVSVVVGELLIVTPTSYPKPFLEPGDLVWINFNGE
VVRGSRKPTSEWRMHVAIYKRRSDVRAVVHTHDVLPVLLADRIDASLLSEAEAYLGSGIS
IVPYLPPGTAELAEAVAAALEKANVAILKRHGVVAVGRDLAEAVNRIEVVADLAKATFYK
TLMDIVELWSVKKGV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagtagacgaattcctcaagtatacacacttgctgtataacagaggccattta
actctcctctctggaaacgtgtctgtggtagttggcgagctccttatagtcaccccgacc
tcatacccaaagccctttttagagcccggcgacttggtgtggatcaactttaacggagag
gtagtaagaggtagccgtaagccaacgagcgaatggcgcatgcatgttgctatatacaag
aggaggagcgacgtgagggcagtagtccacacccacgacgtgttgcctgttctgctcgcc
gataggatagacgcctccctcctctcggaggctgaggcgtatttaggctccggcatatct
atagtgccttatctcccgcctggcactgcggagcttgcagaggcagtcgcggcggcgctt
gaaaaagccaatgtggctattttaaaacgccacggcgtggttgccgtgggcagagacttg
gcagaggccgttaacagaatagaagtagttgccgatttagccaaggccacgttttataaa
acgttaatggatattgtagagctatggagtgtaaagaaaggcgtttaa

DBGET integrated database retrieval system