KEGG   Pyrobaculum aerophilum: PAE2312Help
Entry
PAE2312           CDS       T00073                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pai  Pyrobaculum aerophilum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE2312 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAE2312 (sucC)
   00640 Propanoate metabolism
    PAE2312 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PAE2312 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE2312 (sucC)
Enzymes [BR:pai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PAE2312 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373689..1374837
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFSKYGVKIPPGKVALTPEEVLKIAREIGAPVVLKAQVVVAGRGKAGGIK
VANSPEEAYELSKRMFGMNIKGLIVKKLYVTKFVEVEREMYLSLIIDRASRRYLFLASPV
GGMDIEEIAKTSPEKIKRVYVDPATGLRDYHVRSIVSWLGFKQGTSQWQQAASIVQAMYR
IMVDYDAELVESNPLAVTKEGEVIPLDARVIVDDNALFKHPELEKALEEDPRDVTEFEAY
AKKIGFHYVELDGDVGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVKEAVKV
LLHHPRVKVIFVNIFGGITRADEVALGIKEALAESGGTNKKIVVRMKGTNEELGRAILAE
IGVPLFDSAEEAAKKAVELARV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacacgaatacgaggctaaggagttattttcaaaatacggagttaaaatcccg
cctggtaaagtggcgcttacgcctgaggaggtgttgaaaatcgccagggagataggcgcc
ccagtggtgctaaaggcgcaggtggtggtggccggaaggggcaaggcaggcggcataaaa
gtggctaactccccggaggaggcatatgagctgtctaagagaatgttcgggatgaatatc
aaggggcttatcgtgaagaagctctacgtgactaaattcgtagaggttgagcgcgagatg
tacctctcgcttattatagacagggcgagccgcaggtacctcttcctcgcctctcctgtt
ggcggcatggatatagaggaaatcgccaagacgtctcctgaaaaaatcaagagggtgtac
gtcgaccccgccacgggccttagggattaccatgtgaggtctatagtgtcgtggctaggc
ttcaaacagggcacttcccagtggcaacaagccgcgtcaatagtacaggccatgtacaga
ataatggtggactacgacgcggagcttgtggagtccaaccccctggccgtcactaaagag
ggggaggttataccgctagacgccagggttattgttgacgacaacgcgctatttaaacac
ccggagctggaaaaggcccttgaggaagatcccagggacgtcacggaatttgaggcttac
gccaagaagatagggtttcactacgtagagcttgatggagatgtcggcattatcggcaac
ggcgccggcctcactatggccactatggatttagtctatcactttggaggcaggccggcc
aatttcctcgacataggtgggggggcgagcagagaggtagttaaagaggctgtgaaagtc
ttgctccaccacccaagagtcaaggttattttcgtgaacattttcggcggcattacccgg
gcggatgaggtggccctgggcataaaagaggcgcttgcagagagcggagggacgaataag
aaaatcgtggtgagaatgaagggaacaaatgaggagctcggcagggctattctcgccgaa
ataggcgtgcctctctttgacagcgcagaagaggccgctaaaaaagccgtggagctggcg
agggtatga

DBGET integrated database retrieval system