KEGG   Pyrobaculum aerophilum: PAE2335Help
Entry
PAE2335           CDS       T00073                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pai  Pyrobaculum aerophilum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAE2335
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAE2335
Enzymes [BR:pai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAE2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1390466..1391659
Genome map
AA seq 397 aa AA seqDB search
MESKAVSILSKLISIPTVNPPGEKYAEFVEYVEKLFKTLGLDTEIIEVPKSEVAKRCAEC
ADYPRLILLARSGEPRIHFNGHYDVVPPGPLESWRVTMPFEPVYREGRVYGRGAVDMKGG
LTSIILAVEKAASNGLKNFEVSFVPDEETGGETGAGYLAKSGKIKAPWVVIAEGSGEDNI
WIGHRGLIWFMVEVYGKQAHGSTPWYGLNAFEGAAYIAYRLQEYIKSISSRRSNYEYDDP
RGASPTVTIGGEVRGSVKTNVVPGYFAFSVDRRIIPEEDLEQVKREFVEFIEKVAKELPH
KVEVKITNISEAALVEPNHPLVEALSKSVEEVIGKRPRKTVCIGGLDARFFIKAGHPTVT
YGPGPIGLAHAPDEYVEVKQVINVAEAYYNLIKRVNA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaaaagccgtctctatcttgagtaaattaatttcaatacccacggttaacccg
ccgggcgagaaatacgccgaatttgttgaatatgttgagaagctgtttaagacattgggc
ttagatactgaaatcatagaggttccaaagtctgaagtcgccaagcgttgcgccgaatgt
gctgactatccaaggctaattcttctggcgaggagcggagagccgaggattcatttcaac
gggcattacgatgtcgtcccgccggggccgttagagagctggagagtcactatgcccttt
gagcccgtgtatagagagggcagagtctacggaaggggcgccgtcgatatgaagggagga
cttacttcaataatactggccgtggagaaggccgcgtcaaatgggttgaaaaacttcgag
gtgtcttttgtccccgacgaggagactggcggcgagactggggctgggtatttggccaaa
tcgggtaagataaaggcgccgtgggtagttatagccgagggctctggggaggataacatt
tggattggccacagggggcttatttggttcatggtagaagtttacggaaagcaggcgcac
gggtcaacgccgtggtacgggctaaacgcctttgagggcgcggcttatattgcctacaga
ctgcaagagtatattaagtctatttcctccaggaggagtaattacgaatacgacgacccc
agaggggcgtctcccacggtaacaatagggggcgaagtgaggggctctgttaagactaac
gtagtgcccggctacttcgccttttctgtagaccgtagaattatccctgaggaggactta
gaacaggtgaaaagggaatttgtcgagtttattgaaaaagtggccaaggaattgcctcat
aaagtagaagtgaaaatcacaaatatctcagaggccgcgttagtagagcctaatcatccc
cttgttgaagcgctgtctaaatcagtagaagaggtaattgggaaaaggcctaggaagacg
gtatgtataggagggcttgacgccaggtttttcataaaggctgggcatcccacggtaacc
tacggcccgggtcccatagggctggcccatgcccctgacgaatacgtcgaggtgaaacaa
gtaatcaacgtggccgaggcgtattacaacttaatcaagcgggtcaacgcctag

DBGET integrated database retrieval system