KEGG   Pyrobaculum aerophilum: PAE2458Help
Entry
PAE2458           CDS       T00073                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAE2458
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAE2458
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAE2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1462045..1462746)
Genome map
AA seq 233 aa AA seqDB search
MLSKPGLGVYLVASWPSKDTYEKAIRGLEGIADFFELGLPSKNPKYDGPFIRKAHREAGE
PLWLRPQAPTYIMTYWEEHRGNLDGLFTLAAEIRARGVLAPDLLIDFPEELELYLKYARE
YALAPAFFVPGKFPHWLVKRLTSAEPDFIYLGLYAATGVELPVYVERNVKIIRQLAGDVY
IVAGFAIDSPSKAARLIEAGADGVVVGTAFMRRLQNSVDSALSFLKSIKEALK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcaagcctgggctcggggtatacctcgtggccagctggccgagtaaagacacg
tacgagaaggccattagaggtctggaggggatagcggatttcttcgagctgggattgccg
agtaaaaacccaaaatacgacggtccttttataagaaaggcccatagagaggcgggggag
cctctgtggctccggccccaggccccgacctatatcatgacgtattgggaagagcatagg
ggaaatctagatggtcttttcacgctggcggccgagatcagagcaaggggggttttggcg
ccggacttattaatagacttcccggaggagcttgagctgtacctcaaatacgccagggaa
tacgccctagcgccggcgtttttcgtcccggggaagttcccccactggctagtaaagcgg
ctgacctccgcagagccggattttatatacctcggcctctacgcggcaactggtgtggag
ctgcctgtatacgtggagaggaacgtgaaaattatcagacagctcgcgggagatgtgtat
atagtggcaggttttgccattgactccccttcaaaagccgcgaggcttatagaggctggc
gccgacggcgtggtggtcggaacggcgtttatgcgccgcttgcaaaacagcgttgatagc
gctctctcttttctaaagagcataaaagaggcgcttaaatga

DBGET integrated database retrieval system