KEGG   Pyrobaculum aerophilum: PAE2458Help
Entry
PAE2458           CDS       T00073                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00260  Glycine, serine and threonine metabolism
pai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01130  Biosynthesis of antibiotics
pai01230  Biosynthesis of amino acids
Module
pai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAE2458
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAE2458
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAE2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE ThiG IGPS IMPDH His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: AAL64208
UniProt: Q8ZV48
Position
complement(1462045..1462746)
Genome map
AA seq 233 aa AA seqDB search
MLSKPGLGVYLVASWPSKDTYEKAIRGLEGIADFFELGLPSKNPKYDGPFIRKAHREAGE
PLWLRPQAPTYIMTYWEEHRGNLDGLFTLAAEIRARGVLAPDLLIDFPEELELYLKYARE
YALAPAFFVPGKFPHWLVKRLTSAEPDFIYLGLYAATGVELPVYVERNVKIIRQLAGDVY
IVAGFAIDSPSKAARLIEAGADGVVVGTAFMRRLQNSVDSALSFLKSIKEALK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcaagcctgggctcggggtatacctcgtggccagctggccgagtaaagacacg
tacgagaaggccattagaggtctggaggggatagcggatttcttcgagctgggattgccg
agtaaaaacccaaaatacgacggtccttttataagaaaggcccatagagaggcgggggag
cctctgtggctccggccccaggccccgacctatatcatgacgtattgggaagagcatagg
ggaaatctagatggtcttttcacgctggcggccgagatcagagcaaggggggttttggcg
ccggacttattaatagacttcccggaggagcttgagctgtacctcaaatacgccagggaa
tacgccctagcgccggcgtttttcgtcccggggaagttcccccactggctagtaaagcgg
ctgacctccgcagagccggattttatatacctcggcctctacgcggcaactggtgtggag
ctgcctgtatacgtggagaggaacgtgaaaattatcagacagctcgcgggagatgtgtat
atagtggcaggttttgccattgactccccttcaaaagccgcgaggcttatagaggctggc
gccgacggcgtggtggtcggaacggcgtttatgcgccgcttgcaaaacagcgttgatagc
gctctctcttttctaaagagcataaaagaggcgcttaaatga

DBGET integrated database retrieval system