KEGG   Pyrobaculum aerophilum: PAE2648Help
Entry
PAE2648           CDS       T00073                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE2648
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE2648
   00020 Citrate cycle (TCA cycle)
    PAE2648
   00620 Pyruvate metabolism
    PAE2648
Enzymes [BR:pai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAE2648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1574824..1575975
Genome map
AA seq 383 aa AA seqDB search
MEFKFPDLGEGLVEGEVIKWHVKEGDFVKEGDPLVDVMTEKATVTLPAPTTGRVVKILVR
EGEVVKVGQTLCVIEPAEGPAAGPQTEAPARPREVAAMPAARRLAKELGIDLSKVKGTGP
GGVITVEDVKRYAEETAKATAPAPAPKAVEKAEEAEVVPVRGIRRAVAEKMSKAKRLIPH
AYHLEEVDFTELIKLRERVKAEAEKRGIRLTLLPFIAKAVAMALREYPMLNSEYDEEKNA
IVVKKEVNLGIGVDTEQGLVVVVVKNADKKGLLEMAKEINELAQKAREGKLELQDVRGST
FTISNIGAVGGLGGLSILNYPEAGILAVGQARKKPWAVGDRIEIRDIALLAVSFDHRVVD
GAYVARFMNRVKELLENPWLLLL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaattcccagatctgggggaggggcttgtagagggcgaggtaattaaatgg
catgtaaaagagggtgacttcgtcaaggagggcgaccctctagtggacgtgatgacggag
aaggccacagtcactctgcccgcccccacaacgggcagggtggtgaaaatcctcgtgagg
gagggagaggtggtaaaagtgggccagacgttatgtgtcatcgagccggccgaggggcca
gcggccggcccccagacagaggcgccggcgcgcccgcgcgaggtggcggccatgccagcc
gccagaaggctggccaaagagctggggatagatctctctaaggttaaaggcacaggccca
ggcggcgttattactgtagaagacgtgaaaagatatgcggaggagacagccaaggccacc
gcgccggcccctgcgcctaaagcagtggaaaaggcggaagaggccgaggttgtgccagtg
agggggattaggagggcagttgccgagaagatgtctaaggcgaagaggctaattccccac
gcctatcacttagaggaggtggatttcacagagttaataaaactaagggagagagtcaag
gcagaggccgagaagagggggattaggctcactctgttgccgtttatagcaaaggccgtg
gccatggccttgagggaataccccatgttaaactctgaatacgacgaggagaaaaacgcc
attgtggtgaaaaaagaggtgaatttgggaataggagttgacacagagcaggggctggtt
gtagtggtggttaaaaacgcggataaaaaggggttgttggaaatggcgaaggagataaac
gagctggcacagaaggccagggaggggaagctggagcttcaagatgtgaggggatccacc
tttactattagcaacatcggcgccgtgggaggactaggcggcctctccattttgaactac
ccagaggcggggatactggcggtgggacaggccaggaaaaagccgtgggctgtgggcgat
agaattgagataagggacatagcccttctcgctgtgagttttgaccacagagttgtagac
ggcgcgtatgtggcgcgttttatgaacagagttaaagagcttttggaaaacccctggctt
ttgttgttatga

DBGET integrated database retrieval system