KEGG   Pyrobaculum aerophilum: PAE2648Help
Entry
PAE2648           CDS       T00073                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pai01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pai00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pai00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pai00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1574824..1575975
Genome map
AA seq 383 aa AA seqDB search
MEFKFPDLGEGLVEGEVIKWHVKEGDFVKEGDPLVDVMTEKATVTLPAPTTGRVVKILVR
EGEVVKVGQTLCVIEPAEGPAAGPQTEAPARPREVAAMPAARRLAKELGIDLSKVKGTGP
GGVITVEDVKRYAEETAKATAPAPAPKAVEKAEEAEVVPVRGIRRAVAEKMSKAKRLIPH
AYHLEEVDFTELIKLRERVKAEAEKRGIRLTLLPFIAKAVAMALREYPMLNSEYDEEKNA
IVVKKEVNLGIGVDTEQGLVVVVVKNADKKGLLEMAKEINELAQKAREGKLELQDVRGST
FTISNIGAVGGLGGLSILNYPEAGILAVGQARKKPWAVGDRIEIRDIALLAVSFDHRVVD
GAYVARFMNRVKELLENPWLLLL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaattcccagatctgggggaggggcttgtagagggcgaggtaattaaatgg
catgtaaaagagggtgacttcgtcaaggagggcgaccctctagtggacgtgatgacggag
aaggccacagtcactctgcccgcccccacaacgggcagggtggtgaaaatcctcgtgagg
gagggagaggtggtaaaagtgggccagacgttatgtgtcatcgagccggccgaggggcca
gcggccggcccccagacagaggcgccggcgcgcccgcgcgaggtggcggccatgccagcc
gccagaaggctggccaaagagctggggatagatctctctaaggttaaaggcacaggccca
ggcggcgttattactgtagaagacgtgaaaagatatgcggaggagacagccaaggccacc
gcgccggcccctgcgcctaaagcagtggaaaaggcggaagaggccgaggttgtgccagtg
agggggattaggagggcagttgccgagaagatgtctaaggcgaagaggctaattccccac
gcctatcacttagaggaggtggatttcacagagttaataaaactaagggagagagtcaag
gcagaggccgagaagagggggattaggctcactctgttgccgtttatagcaaaggccgtg
gccatggccttgagggaataccccatgttaaactctgaatacgacgaggagaaaaacgcc
attgtggtgaaaaaagaggtgaatttgggaataggagttgacacagagcaggggctggtt
gtagtggtggttaaaaacgcggataaaaaggggttgttggaaatggcgaaggagataaac
gagctggcacagaaggccagggaggggaagctggagcttcaagatgtgaggggatccacc
tttactattagcaacatcggcgccgtgggaggactaggcggcctctccattttgaactac
ccagaggcggggatactggcggtgggacaggccaggaaaaagccgtgggctgtgggcgat
agaattgagataagggacatagcccttctcgctgtgagttttgaccacagagttgtagac
ggcgcgtatgtggcgcgttttatgaacagagttaaagagcttttggaaaacccctggctt
ttgttgttatga

DBGET integrated database retrieval system