KEGG   Pyrobaculum aerophilum: PAE2878Help
Entry
PAE2878           CDS       T00073                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAE2878
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAE2878
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAE2878
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAE2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1704557..1705603)
Genome map
AA seq 348 aa AA seqDB search
MLEVEVRNKVWAPKGNGIWRYSTMLPLKSGISLGEGRTPLVKSNLAENLYVKFEGANPTG
SFKDRGMALGVTVAKESGANKVVVASTGNTAASAAAYAARAGLRCYVVLPKGNVARGKLI
QAALHGAELVMINGLFDKALDYVVNYGTKYAYPLNSFNPWRLEGQKTVAFEIYEELGCPD
YVIVPVGNAGNISAIWKGFRELAELGLCNKLPKMVGVQAEGAAPLVEAWARGVEEPLFVD
EPNTVATAIKIGRPINWPKALRAVKESGGFFVKVSDGEILKAQRLLATRDGIGAEPAGAA
SIAAAIKLNIGGVAVAVVTGHALKDPDVIEITAKEVRNADELIELLEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaagtggaagttcgtaataaagtctgggccccaaagggcaacgggatctggcgt
tattcaacaatgttgcctcttaaaagcgggatatccctgggagaggggaggacccccctg
gtgaaatccaatctggcggagaatctgtatgtaaaatttgaaggggctaacccaactgga
agttttaaagaccggggaatggccctcggcgtgactgtggccaaggagagcggcgccaat
aaagtcgtcgtggcgtctactggcaacacggcggcctctgcggcggcttacgccgctagg
gctgggcttaggtgttatgtagttttgcccaagggcaatgtggccagggggaagttaata
caagcggcgttacacggcgctgagcttgttatgataaacggcctatttgataaggcgctt
gactacgtggttaactacgggacaaaatacgcatatcctctaaacagctttaacccgtgg
aggctggaggggcagaagaccgtggcctttgagatatacgaagagctggggtgtccggac
tacgtaatagtgccagtgggaaacgcggggaatatctcggctatatggaaggggtttagg
gaactcgccgagctggggctttgtaataaactgccgaaaatggtgggcgtccaggcggag
ggcgcggcgccgcttgtcgaggcctgggcccgcggcgtggaggagccgctttttgtagac
gagcctaacacagtggcgacggcaattaaaatcggcaggcctataaactggcccaaggcg
ctgagggccgtgaaggagtcaggaggctttttcgtaaaagtgtctgacggggagatatta
aaggcgcagaggctcttggcaactcgcgacggcataggggcggagcccgcgggcgccgcg
tcaatagccgcggcgattaaattaaatatagggggagtagccgtggccgtggtaaccggc
catgcgctgaaagaccccgacgttatagaaataacagcgaaggaggtgagaaatgcagac
gagctgatagagcttttggaaaaatga

DBGET integrated database retrieval system