KEGG   Pyrobaculum aerophilum: PAE2878Help
Entry
PAE2878           CDS       T00073                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00260  Glycine, serine and threonine metabolism
pai00750  Vitamin B6 metabolism
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
pai01230  Biosynthesis of amino acids
Module
pai_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAE2878
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAE2878
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAE2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAL64506
UniProt: Q8ZUA2
Position
complement(1704557..1705603)
Genome map
AA seq 348 aa AA seqDB search
MLEVEVRNKVWAPKGNGIWRYSTMLPLKSGISLGEGRTPLVKSNLAENLYVKFEGANPTG
SFKDRGMALGVTVAKESGANKVVVASTGNTAASAAAYAARAGLRCYVVLPKGNVARGKLI
QAALHGAELVMINGLFDKALDYVVNYGTKYAYPLNSFNPWRLEGQKTVAFEIYEELGCPD
YVIVPVGNAGNISAIWKGFRELAELGLCNKLPKMVGVQAEGAAPLVEAWARGVEEPLFVD
EPNTVATAIKIGRPINWPKALRAVKESGGFFVKVSDGEILKAQRLLATRDGIGAEPAGAA
SIAAAIKLNIGGVAVAVVTGHALKDPDVIEITAKEVRNADELIELLEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaagtggaagttcgtaataaagtctgggccccaaagggcaacgggatctggcgt
tattcaacaatgttgcctcttaaaagcgggatatccctgggagaggggaggacccccctg
gtgaaatccaatctggcggagaatctgtatgtaaaatttgaaggggctaacccaactgga
agttttaaagaccggggaatggccctcggcgtgactgtggccaaggagagcggcgccaat
aaagtcgtcgtggcgtctactggcaacacggcggcctctgcggcggcttacgccgctagg
gctgggcttaggtgttatgtagttttgcccaagggcaatgtggccagggggaagttaata
caagcggcgttacacggcgctgagcttgttatgataaacggcctatttgataaggcgctt
gactacgtggttaactacgggacaaaatacgcatatcctctaaacagctttaacccgtgg
aggctggaggggcagaagaccgtggcctttgagatatacgaagagctggggtgtccggac
tacgtaatagtgccagtgggaaacgcggggaatatctcggctatatggaaggggtttagg
gaactcgccgagctggggctttgtaataaactgccgaaaatggtgggcgtccaggcggag
ggcgcggcgccgcttgtcgaggcctgggcccgcggcgtggaggagccgctttttgtagac
gagcctaacacagtggcgacggcaattaaaatcggcaggcctataaactggcccaaggcg
ctgagggccgtgaaggagtcaggaggctttttcgtaaaagtgtctgacggggagatatta
aaggcgcagaggctcttggcaactcgcgacggcataggggcggagcccgcgggcgccgcg
tcaatagccgcggcgattaaattaaatatagggggagtagccgtggccgtggtaaccggc
catgcgctgaaagaccccgacgttatagaaataacagcgaaggaggtgagaaatgcagac
gagctgatagagcttttggaaaaatga

DBGET integrated database retrieval system