KEGG   Pyrobaculum aerophilum: PAE2931Help
Entry
PAE2931           CDS       T00073                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PAE2931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE2931
  Lipid metabolism
   00071 Fatty acid degradation
    PAE2931
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAE2931
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAE2931
   00626 Naphthalene degradation
    PAE2931
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAE2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740816..1741877)
Genome map
AA seq 353 aa AA seqDB search
MKIPIKMRAALYKAPGQPLELAETEIPTPGEGEILIKVAATGVCHSDLHILDGEIVPPPE
GFILGHEVSGWVVDFGPRCENPHGLSPGDPVVISWIIPCGKCYWCVRGQENYCPYAAARM
PGLVGLNGGHAEYMSVPETAVFPIPKEVDVHTAAVISCAYGTAYRALKEAAVGPGTSLVV
IGVGGVGLAAVELASALGARPIIAVDVRKHVLEKAAELGATHLINATNGDPLSKIRDILP
QGADVVYETKPNPDLKLAVEIVRRGGTIVVTGLGTSTIEIPANHIVMNGIRIIGSLGYKP
RTDIPELLTLAASGKIKPQRLISHKYAPNEINEAYKNLRIGLHHRAIIIWNTK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacccattaaaatgagagccgccctctataaagcgccaggacagcctctagaa
ttagccgaaacagaaatccctactccgggagaaggggaaatattgataaaagtcgccgcc
acgggggtctgccactcagatctccacattctagacggggaaatcgtcccccctccagag
ggctttattctagggcatgaagtatctgggtgggttgtggatttcggccctcgttgtgaa
aacccccacggactatcgcccggcgatcctgttgtaatatcttggattataccatgtggc
aaatgttattggtgtgtgagaggccaggagaactactgtccttacgccgccgctagaatg
cccggcttagtggggctaaacggaggccatgcagaatatatgtcagtgccagaaacagca
gtctttccaattccaaaagaagttgacgtacacacagcagcagtcatatcatgcgcctac
gggacagcctacagagcgctaaaagaagcggcagttggcccgggtacctctcttgtagta
attggcgttgggggcgtgggtctagcggccgtggagctggcgagcgccctaggcgcccgc
cccataattgcagttgacgtgagaaaacacgtcctggaaaaagccgcagagctgggggcg
actcacttaataaatgcaactaacggagaccctttaagcaagataagagatatcttgcca
caaggcgcagacgtcgtatatgaaacaaagccaaacccagatctcaaattagccgtggaa
attgttaggagagggggaacaatagttgtcacaggattaggcacatcaactatcgaaatc
ccggcaaatcacatcgtaatgaacggaattaggataataggaagcctagggtataagccc
agaacggacataccagaactattaacactagccgcaagtggaaaaataaaaccgcaacgc
cttatctctcacaaatatgctccaaatgaaataaacgaagcatataaaaatctaagaatt
ggcttacatcacagagctattattatttggaatacaaaataa

DBGET integrated database retrieval system