KEGG   Pyrobaculum aerophilum: PAE3275Help
Entry
PAE3275           CDS       T00073                                 

Definition
2-ketoacid ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE3275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3275
   00020 Citrate cycle (TCA cycle)
    PAE3275
   00620 Pyruvate metabolism
    PAE3275
   00640 Propanoate metabolism
    PAE3275
   00650 Butanoate metabolism
    PAE3275
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE3275
   00680 Methane metabolism
    PAE3275
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE3275
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1965678..1966832)
Genome map
AA seq 384 aa AA seqDB search
MKTLAVQKTALTGNYAVAYAVKMAKPHVIAAYPITPQTSIVEKLSEFVEKGELNARFVNV
ESEFAGMSVVYGAAMAGARAFTATSSHGLLYMYEATWWAALSRAPVVMAVVTRTIGPPWN
IHVEHNDILVLRDSGWIIAMAENVQEVFDLTLQAFKIAETAVLPMAVGLDGFVLSHSTEP
VEIPPQEAVDKFLPPRRPDVPLLLRPGEPVVFGNLPSDNRIHARHKIATVYEAQREAKKV
IDQVDWEYGKIIGRNYGGLVEWYKASDAKNIVVCMGAWCSDAKQAVDALRKRSIPVGLMR
VRFLRPFPLEEVSQLDQYEKVIVYDRDITPLGGVLGIEIKAALSKASVINIVAGIAGVDF
DVQNFYETIQKAIEGSYKGIEFAI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttggcagttcaaaaaaccgcattgacgggcaattatgcagtggcctacgct
gtgaaaatggctaagccgcatgtaatagcggcatacccaattaccccccagacttcaata
gtggaaaaactttcagaattcgtcgaaaaaggggaattaaacgcgaggtttgttaacgtg
gagtcggaattcgcggggatgtcagtagtatacggcgccgcgatggccggcgctagggct
tttacagccacatcttctcacgggctgttatatatgtatgaggcgacttggtgggccgct
ctcagcagggcgcccgtggtaatggccgtggtgactcgcaccataggccctccgtggaat
atacatgtggaacacaacgacattctagtcttaagagattccgggtggattatcgcaatg
gcggagaacgtacaagaggtatttgacctaacacttcaagcgtttaaaatagcggaaacc
gccgtcctcccaatggctgttggacttgacggctttgtgttaagccactccaccgagccc
gtggaaatacctccccaggaggcggtggataaattcttgcctccccgtaggccggacgtc
ccgttgttgctccgtcccggcgagcccgtggttttcggcaacctgccctctgataacaga
atacatgcaagacataaaatagcgacagtctatgaggcacagagagaggcaaaaaaggtg
atagatcaagtagattgggaatatggcaaaataataggcagaaattacggcgggctagtt
gagtggtacaaagccagcgacgccaagaatattgtagtgtgcatgggcgcttggtgtagc
gacgcaaaacaagcagtcgacgcccttagaaaacgcagcataccagtgggcttaatgaga
gtgagatttctgaggccattcccgctggaggaagtatcccaactggaccaatacgaaaaa
gtaattgtatacgacagagacataacgccgcttgggggagtgcttggaattgaaatcaag
gccgccttgtcaaaagcctccgtaataaacatcgtggcagggatagcaggcgtggacttc
gacgttcaaaatttctatgagactattcagaaggccattgagggcagttataaaggaata
gaattcgcgatatga

DBGET integrated database retrieval system