KEGG   Pyrobaculum aerophilum: PAE3275Help
Entry
PAE3275           CDS       T00073                                 

Definition
(GenBank) 2-ketoacid ferredoxin oxidoreductase alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00020  Citrate cycle (TCA cycle)
pai00620  Pyruvate metabolism
pai00633  Nitrotoluene degradation
pai00640  Propanoate metabolism
pai00650  Butanoate metabolism
pai00680  Methane metabolism
pai00720  Carbon fixation pathways in prokaryotes
pai01100  Metabolic pathways
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01200  Carbon metabolism
Module
pai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3275
   00020 Citrate cycle (TCA cycle)
    PAE3275
   00620 Pyruvate metabolism
    PAE3275
   00640 Propanoate metabolism
    PAE3275
   00650 Butanoate metabolism
    PAE3275
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE3275
   00680 Methane metabolism
    PAE3275
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE3275
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C OxoGdeHyase_C
Motif
Other DBs
NCBI-ProteinID: AAL64805
UniProt: Q8ZTF6
Position
complement(1965678..1966832)
Genome map
AA seq 384 aa AA seqDB search
MKTLAVQKTALTGNYAVAYAVKMAKPHVIAAYPITPQTSIVEKLSEFVEKGELNARFVNV
ESEFAGMSVVYGAAMAGARAFTATSSHGLLYMYEATWWAALSRAPVVMAVVTRTIGPPWN
IHVEHNDILVLRDSGWIIAMAENVQEVFDLTLQAFKIAETAVLPMAVGLDGFVLSHSTEP
VEIPPQEAVDKFLPPRRPDVPLLLRPGEPVVFGNLPSDNRIHARHKIATVYEAQREAKKV
IDQVDWEYGKIIGRNYGGLVEWYKASDAKNIVVCMGAWCSDAKQAVDALRKRSIPVGLMR
VRFLRPFPLEEVSQLDQYEKVIVYDRDITPLGGVLGIEIKAALSKASVINIVAGIAGVDF
DVQNFYETIQKAIEGSYKGIEFAI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttggcagttcaaaaaaccgcattgacgggcaattatgcagtggcctacgct
gtgaaaatggctaagccgcatgtaatagcggcatacccaattaccccccagacttcaata
gtggaaaaactttcagaattcgtcgaaaaaggggaattaaacgcgaggtttgttaacgtg
gagtcggaattcgcggggatgtcagtagtatacggcgccgcgatggccggcgctagggct
tttacagccacatcttctcacgggctgttatatatgtatgaggcgacttggtgggccgct
ctcagcagggcgcccgtggtaatggccgtggtgactcgcaccataggccctccgtggaat
atacatgtggaacacaacgacattctagtcttaagagattccgggtggattatcgcaatg
gcggagaacgtacaagaggtatttgacctaacacttcaagcgtttaaaatagcggaaacc
gccgtcctcccaatggctgttggacttgacggctttgtgttaagccactccaccgagccc
gtggaaatacctccccaggaggcggtggataaattcttgcctccccgtaggccggacgtc
ccgttgttgctccgtcccggcgagcccgtggttttcggcaacctgccctctgataacaga
atacatgcaagacataaaatagcgacagtctatgaggcacagagagaggcaaaaaaggtg
atagatcaagtagattgggaatatggcaaaataataggcagaaattacggcgggctagtt
gagtggtacaaagccagcgacgccaagaatattgtagtgtgcatgggcgcttggtgtagc
gacgcaaaacaagcagtcgacgcccttagaaaacgcagcataccagtgggcttaatgaga
gtgagatttctgaggccattcccgctggaggaagtatcccaactggaccaatacgaaaaa
gtaattgtatacgacagagacataacgccgcttgggggagtgcttggaattgaaatcaag
gccgccttgtcaaaagcctccgtaataaacatcgtggcagggatagcaggcgtggacttc
gacgttcaaaatttctatgagactattcagaaggccattgagggcagttataaaggaata
gaattcgcgatatga

DBGET integrated database retrieval system