KEGG   Pyrobaculum aerophilum: PAE3279Help
Entry
PAE3279           CDS       T00073                                 

Definition
2-ketoacid ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE3279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3279
   00020 Citrate cycle (TCA cycle)
    PAE3279
   00620 Pyruvate metabolism
    PAE3279
   00640 Propanoate metabolism
    PAE3279
   00650 Butanoate metabolism
    PAE3279
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE3279
   00680 Methane metabolism
    PAE3279
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE3279
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967227..1967778
Genome map
AA seq 183 aa AA seqDB search
MSKLLVYEVIFLGRGGQGAVTAAQLLAYAAALEGKKAQALPEFGAERRGAIVRAYLRIGE
ALLHSSIKRADYVVVLDGRIIEQIDVRQYGKPGAVYIVNTKTQADWYVPIDATSIALKYG
LVVAGWTVVNLIMAAAFAAVSGLISLESIIKAVPEYVPRKYVDANVKAVIEGYEIAKRLV
KVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaacttcttgtgtatgaggtaatttttctagggcgtggaggccaaggggcagtt
acggcggcgcaattattggcatacgcggcggctctagagggcaagaaagcccaggcactg
cctgagtttggcgccgagaggagaggcgctattgtgagggcctatttaagaatcggcgaa
gcgctcctccactcctcaataaaaagggcggactatgtagtggtgttagacggccgaatt
attgaacagatagacgtaagacaatacggcaaacccggagctgtgtatatagtgaataca
aaaactcaggcagactggtatgtcccgatagacgctacgtcaattgcgctgaagtacggc
ctagttgttgccggatggactgtggttaatctcattatggcggcggcttttgcggcagtc
agcggcttgatatctctagagagtataatcaaggctgttcccgaatacgtaccgagaaag
tacgtggacgccaatgtaaaggccgtaatagaggggtatgaaattgccaaaaggcttgtg
aaagtcggttaa

DBGET integrated database retrieval system