KEGG   Pyrobaculum aerophilum: PAE3416Help
Entry
PAE3416           CDS       T00073                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pai  Pyrobaculum aerophilum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAE3416
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE3416
   00680 Methane metabolism
    PAE3416
Enzymes [BR:pai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PAE3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2043807..2045189)
Genome map
AA seq 460 aa AA seqDB search
MYIPCLMCTQHPDSTVKITAGEEVDEAVVAFLAYGCDEVMVDYEGKATPYSQPRDVASKA
LALGLPLGERFFITPRVPNPRLEDFERSMLSLEAAVLANSYSQRAAGVQAVKWVVLPMTE
DVETMAFVYKALDMKARDLAELNAVKRDSSIELIPLVEDAMRQIKIESFIKALFRTAAQS
GRILEHMRIFLGISDSAVRHGHMASALAMVKALGQISEINRDGEFKISPIVGMGSPPFRG
GLNNPHLAVPEAAQYAGYKTATIQSAVRYDVSYAEYQKVREAILSVYTPRRLHVEEAWIT
KASELYREAIRPYIGKIAELANAIPSTRDRVSWREYGRVIEGVEWRVPRAIVYTATWYFA
GVPPTLLDARFIAWAYKNDLLDDVLRALPATVEEWKFESRFYSRERAEKTLGGEIVKDID
NAFDILGIKPEPDRTYITLLNSADTQPHAIALGRIRGFLG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtatataccgtgtcttatgtgtactcaacaccccgactccacagttaaaatcacggcg
ggagaggaagtagacgaggcagtagtcgcgtttttggcctatggatgcgacgaggtcatg
gtggactacgaagggaaggcaactccctattcacaacctagagacgtggcctctaaggcg
ctggcgctggggcttcccctgggcgagcggtttttcataacgccaagagtgcccaacccc
cgccttgaggattttgaacgcagcatgctgtcgcttgaggcggcagttttggccaacagc
tactcacagagggcggctggggtccaggcagttaagtgggttgtactgccaatgactgaa
gatgtggagactatggcctttgtatataaggcgctggacatgaaggccagagacttggcc
gagctaaacgcagtaaaacgcgactcatccatagagctgataccgcttgtagaagacgcc
atgcgccagataaaaatagagagtttcataaaagccttattccgaacggcggcgcagagc
ggccgcattttagaacacatgagaatattcctggggatatccgactcagcggtgcgccac
gggcatatggcctccgcgctggccatggtaaaagcgcttggccaaatctccgagataaac
agagatggggagtttaagatatctcccattgtcggcatgggatcgcccccatttagaggc
ggcctcaacaatccccatttggcagttcccgaggcggcgcaatacgccggctataagact
gccactattcaatcagccgttagatacgacgtgtcttacgccgagtatcaaaaggtaaga
gaggccatattaagcgtctatacgccccgtcgtttacacgtcgaagaggcgtggattaca
aaagcctcagagctctaccgcgaagccataaggccttatataggcaaaatagccgaatta
gccaacgccatcccttccactagagatcgcgtctcttggagggagtacgggagagttata
gagggagtggagtggcgcgtccccagggctattgtgtacacagcaacttggtatttcgcg
ggcgtgccgccaacactgctcgacgcacggtttatagcatgggcatataaaaacgacttg
ttagatgacgtgttgagagcgctgcccgcaaccgtagaagagtggaaatttgaatcgagg
ttttacagcagagagagggctgaaaaaaccctaggaggggagatagttaaggacatagac
aacgcctttgacatacttggcataaagccagagcctgatcgcacgtacatcacattgtta
aattcggcagatacacaaccacacgcaattgctctgggcaggataaggggttttttgggc
taa

DBGET integrated database retrieval system