KEGG   Pyrobaculum aerophilum: PAE3437Help
Entry
PAE3437           CDS       T00073                                 

Definition
(GenBank) glucokinase (ROK family protein), conjectural
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00052  Galactose metabolism
pai00500  Starch and sucrose metabolism
pai00520  Amino sugar and nucleotide sugar metabolism
pai00521  Streptomycin biosynthesis
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3437
   00052 Galactose metabolism
    PAE3437
   00500 Starch and sucrose metabolism
    PAE3437
   00520 Amino sugar and nucleotide sugar metabolism
    PAE3437
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAE3437
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PAE3437
Enzymes [BR:pai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAE3437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG MutL Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AAL64914
UniProt: Q8ZT49
Position
complement(2060281..2061171)
Genome map
AA seq 296 aa AA seqDB search
MTLYLGIDVGATWTRAILIDENLQVFKRLKIRTGVNPLADVAVAVEKWSFDSIGVGSIGP
MDLRSGRVVNSPNSPSRQFPLVEPLKKFGKPVVVANDCVAAVWGEYVFKHRVENLVYVTL
STGVGIGAIVNGTLLLGKDGNAHELGHAVIDFRSSRQCGCGGFGHFEAYVGGANIPKWFQ
ELTGEALNDAAEVFKRYRDGDFKARQFIDLWLDALAAGIATVIAAYDPELLIIGGSIGLN
NWDIISRDLPIRLKKYLGVRPPAITQASFGDDEVAIGAAALAYRVPESLKKFGYPR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgtacctcggaattgacgtaggggccacctggactagggcgattttaatagat
gaaaatctccaggtttttaaaagattaaaaatcagaactggggttaatccgctggccgat
gtggcggtggctgtggaaaaatggagttttgacagtattggcgtcgggtcaattgggcct
atggatttaagaagcggacgggtagttaactcgcccaattcgccctctaggcaattcccc
ttagtggagccgctgaaaaaattcggcaaacccgtagtggtggcaaacgactgcgttgcg
gcggtgtggggagagtacgtctttaaacaccgtgtggaaaacttagtttacgtcacgttg
tcaacgggagtggggattggggctattgtaaacgggactttattattgggcaaagatgga
aatgcccacgagctcggacacgcagttatagacttccgctctagccgccaatgtggatgc
ggtggttttggccactttgaggcgtatgtgggaggggcgaatatacccaagtggtttcaa
gagctgacgggcgaggcgcttaatgacgccgctgaggtttttaaaagatatagagatggg
gattttaaagcgcggcagtttatcgacttgtggcttgacgctttagccgccggcattgcc
actgtaattgccgcctatgatccagagctgttaataatagggggatccatagggcttaat
aactgggatattatatctagagatttgcccatacgtctaaagaagtacctcggcgtgagg
ccgccggctattactcaagcctctttcggcgacgacgaggtggcaataggcgccgcggcc
ttggcgtacagagtaccagaaagtttgaagaaattcggctaccctagatag

DBGET integrated database retrieval system