KEGG   Pyrobaculum aerophilum: PAE3437Help
Entry
PAE3437           CDS       T00073                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAE3437
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3437
   00052 Galactose metabolism
    PAE3437
   00500 Starch and sucrose metabolism
    PAE3437
   00520 Amino sugar and nucleotide sugar metabolism
    PAE3437
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAE3437
   00524 Butirosin and neomycin biosynthesis
    PAE3437
Enzymes [BR:pai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAE3437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2060281..2061171)
Genome map
AA seq 296 aa AA seqDB search
MTLYLGIDVGATWTRAILIDENLQVFKRLKIRTGVNPLADVAVAVEKWSFDSIGVGSIGP
MDLRSGRVVNSPNSPSRQFPLVEPLKKFGKPVVVANDCVAAVWGEYVFKHRVENLVYVTL
STGVGIGAIVNGTLLLGKDGNAHELGHAVIDFRSSRQCGCGGFGHFEAYVGGANIPKWFQ
ELTGEALNDAAEVFKRYRDGDFKARQFIDLWLDALAAGIATVIAAYDPELLIIGGSIGLN
NWDIISRDLPIRLKKYLGVRPPAITQASFGDDEVAIGAAALAYRVPESLKKFGYPR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgtacctcggaattgacgtaggggccacctggactagggcgattttaatagat
gaaaatctccaggtttttaaaagattaaaaatcagaactggggttaatccgctggccgat
gtggcggtggctgtggaaaaatggagttttgacagtattggcgtcgggtcaattgggcct
atggatttaagaagcggacgggtagttaactcgcccaattcgccctctaggcaattcccc
ttagtggagccgctgaaaaaattcggcaaacccgtagtggtggcaaacgactgcgttgcg
gcggtgtggggagagtacgtctttaaacaccgtgtggaaaacttagtttacgtcacgttg
tcaacgggagtggggattggggctattgtaaacgggactttattattgggcaaagatgga
aatgcccacgagctcggacacgcagttatagacttccgctctagccgccaatgtggatgc
ggtggttttggccactttgaggcgtatgtgggaggggcgaatatacccaagtggtttcaa
gagctgacgggcgaggcgcttaatgacgccgctgaggtttttaaaagatatagagatggg
gattttaaagcgcggcagtttatcgacttgtggcttgacgctttagccgccggcattgcc
actgtaattgccgcctatgatccagagctgttaataatagggggatccatagggcttaat
aactgggatattatatctagagatttgcccatacgtctaaagaagtacctcggcgtgagg
ccgccggctattactcaagcctctttcggcgacgacgaggtggcaataggcgccgcggcc
ttggcgtacagagtaccagaaagtttgaagaaattcggctaccctagatag

DBGET integrated database retrieval system