KEGG   Pantoea ananatis AJ13355: PAJ_0208Help
Entry
PAJ_0208          CDS       T01969                                 

Gene name
mtnD
Definition
(GenBank) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase MtnD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00270  Cysteine and methionine metabolism
paj01100  Metabolic pathways
Module
paj_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAJ_0208 (mtnD)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PAJ_0208 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PAJ_0208 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding KicB
Motif
Other DBs
NCBI-ProteinID: BAK10288
UniProt: A0A0H3KXA4
Position
246042..246647
Genome map
AA seq 201 aa AA seqDB search
MMTAIIVRSPIFPRLTRSRFEMSALTIFSDSDPSQPIWHSTDAEAIRARLNAKDVRFERW
QADRDLGENPDAETVINAYQHAIDRLVAEKGYQSWDVISMRADNPQKDVLRQKFLSEHTH
GEDEVRFFVEGAGLFCLHLDGEILQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDN
QEGWIANFTGDKIADAYPRLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagccatcatcgtcaggtcgccgatttttcccagattaacccggagtcgattt
gagatgagtgcactgaccatttttagcgatagcgatcccagccagccgatatggcacagc
accgatgctgaggcgattcgcgcgcggctgaatgccaaagacgtccgttttgaacgctgg
caggccgaccgcgatctgggcgaaaacccggatgcggaaacggtcatcaacgcctatcag
catgccatcgaccggctggtggccgaaaaaggctatcagagctgggatgtgattagcatg
cgtgccgataacccgcagaaggacgttctgcgccagaagtttctgtcggaacacacgcac
ggcgaagatgaagtgcgcttctttgtcgagggtgcggggctgttttgtctgcatctggac
ggtgaaattttgcagatcctgtgcgaaaagaacgatctgatctcggtgcccgccggcacg
ccgcactggtttgatatgggatcgtccccgcacttcaccgcgattcgcatttttgataat
caggaaggctggatcgccaatttcaccggcgacaagattgccgatgcctatccgcgcctc
gcgtaa

DBGET integrated database retrieval system