KEGG   Pantoea ananatis AJ13355: PAJ_0311Help
Entry
PAJ_0311          CDS       T01969                                 

Gene name
adhP
Definition
alcohol dehydrogenase AdhP
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PAJ_0311 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_0311 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    PAJ_0311 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAJ_0311 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAJ_0311 (adhP)
   00626 Naphthalene degradation
    PAJ_0311 (adhP)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAJ_0311 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378485..379525
Genome map
AA seq 346 aa AA seqDB search
MTMKINTMMKAAVVKAFGEPLVIEQVPVPQPGSGQILVKIAATGVCHTDLHAAEGDWPVK
PVPPFIPGHEGVGQVVAVGDNVHHLKVGDRVGVPWLYSACGHCEHCLDNWETLCHSQQNT
GYSVNGSFAEYCVADANYVGIIPENLAFNEVAPVLCAGVTVYKGLKMTDTKPGDWVVISG
IGGLGHMAIQYAVAMGLNVAAVDIDDDKLAFAQRLGASVVANARNVDPARVFHEHFGGAH
GVLVTAVSPKAFEQAIGTLRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRKDL
QEALDFASRHKVKASVAVEPLSNINDIFARMHAGKIEGRIVVDMSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaaaatcaacacgatgatgaaggcagcagttgttaaagcgttcggcgaaccc
ttggtgattgagcaggtgcccgtaccccagcctgggtcggggcagattctggtaaaaatc
gcggcaactggcgtgtgtcacaccgatctgcatgcggcagagggcgactggccggtgaag
ccggttccgccttttatcccgggacatgagggcgtcgggcaggtggtcgcggtgggagat
aacgtacatcacctgaaggtgggcgatcgggtcggcgtgccctggctctactccgcctgc
ggtcactgcgagcactgtctcgataactgggaaacgctgtgccacagtcagcaaaatacc
ggctattcggttaacggcagttttgccgaatactgcgtggcggacgccaactatgtcggc
atcatccccgaaaacctcgcattcaacgaggtggcaccggtgctctgtgcgggcgtgacg
gtctacaaagggttaaaaatgaccgacaccaaacccggtgactgggtggtgatttccggc
ataggtgggttagggcacatggctatacagtatgccgtcgcgatggggctgaacgtggcg
gctgtcgatatcgatgacgataagctggcctttgcccagcgcctgggcgccagcgtggtg
gcgaatgccagaaacgtcgatccggccagggtgtttcatgagcactttggcggcgcgcac
ggcgtgctggtcactgcggtgtcgcctaaagcctttgagcaggcgatcggcacgttacgt
cgtgggggcaccatggtgctaaacggcttgccgcctggcaaattcgatctgtctattttc
gatatggtgctggacggcattacggtgcggggttctatcgtcggaacgcgtaaggattta
caggaggcgctggattttgccagccgtcataaagtgaaagccagcgtggcggtggaaccg
ctcagcaatattaacgatatctttgcccggatgcatgcgggcaagattgaaggccgtatt
gtggtggatatgtcgttgtaa

DBGET integrated database retrieval system