KEGG   Pantoea ananatis AJ13355: PAJ_0464Help
Entry
PAJ_0464          CDS       T01969                                 

Gene name
asnB
Definition
asparagine synthetase B [glutamine-hydrolyzing] AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:paj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573722..575389)
Genome map
AA seq 555 aa AA seqDB search
MCSIFGVLDLKSDPVELRKKALESSRLMRHRGPDWSGVYADDHAILAHERLSIVDVNNGA
QPLYNADHTHVLAVNGEIYNHQALRAKLSDRYAFQTGSDCEVILALYQEKGVDFLDELEG
MFAFILYDSVKGTYLIGRDHIGIIPLYMGNDEHGNLFVASEMKALVPVCRSIKEFPPGSY
LSSTDGEIRRYWQRDWMEYQNVENNVTDAAELKHALEESVKSHLMSDVPYGVLLSGGLDS
SIISAVTKRFAAKRVEDQDKSDAWWPQLHSFAVGLEGSPDLKAAKLVAEHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAKEFHEENVRKLLALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGSNGKMEKHILRECFSSYLPESVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLA
TAHFRFPYNTPGSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKNMD
DPSGRAVGVHQSAYK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtgctggatctgaaaagcgatcccgttgagttacgtaaaaaa
gcattggaaagctcacgtttgatgcgtcaccgtgggccggactggtcaggcgtttacgcc
gatgaccacgccattcttgctcatgagcgcctctcaattgttgacgtgaacaacggtgca
cagccgctgtataacgctgaccacacccacgtactggcagtcaatggtgagatctacaac
catcaggccctgcgcgcaaaattaagcgatcgctacgcgtttcagaccggttctgactgc
gaagtgattctggcgctgtaccaggagaaaggtgtcgattttcttgacgaactggaaggc
atgtttgccttcatcctgtatgacagcgtcaaaggcacctatctgattggccgtgaccat
atcggtatcatcccgctgtatatgggcaacgatgagcacggtaacctgtttgtcgcctca
gaaatgaaagcgctggtgccagtgtgccgttcaatcaaagaattcccgccgggaagctac
ctttccagcaccgacggtgaaattcgtcgttactggcagcgtgactggatggaataccag
aacgttgagaacaacgtgactgacgcagcagaactgaaacatgcgctggaagagtcagta
aaaagccacctgatgtccgatgttccgtatggcgtgctgctgtctggtggtctggactcg
tcaattatttcagcggtaaccaaacgtttcgcggccaaacgcgtggaagatcaggataaa
agtgatgcctggtggccacagctgcactcgttcgcggtcggtctggaaggatcgccggat
ctgaaagcggccaaactggtggcagagcatctgggtacggtgcaccacgaaattcacttc
acggtgcaggaaggcctggatgcgattcgtgacgtgatctaccacattgaaacctatgat
gtgaccacgattcgcgcctccacaccgatgtacctgatgtcgcgtaagattaaagccatg
ggcatcaaaatggtgctgtcgggcgaaggggctgacgaagtctttggtggttatctgtat
ttccataaagcgccaaacgcgaaagagttccatgaggagaacgttcgcaaactgctggcc
ctgcatatgtttgactgcgcacgcgccaacaaagcgatgtctgcctggggcgttgaagca
cgcgtgccgttcctggataagaaattcctggatgtcgccatgcgtattaacccacaagac
aagatgtgcggcagcaacggtaaaatggaaaaacacattctgcgtgaatgcttctcctct
tacctgcccgaaagcgtggcctggcgccagaaagagcagttctctgacggcgtgggttac
agctggattgacacactgaaagaagtcgcggccaaacaaatcagcgatcagcaactggcg
acggcgcacttccgtttcccgtataacacgccggggtcgaaagaagcgtacctgtaccgt
gaaatctttgaagaactcttcccactgccgagcgctgccgagtgcgtaccaggcgggccg
tctgttgcctgttcatcggcaaaagccatcgagtgggacgaagcctttaaaaacatggat
gacccgtcaggacgtgccgtaggcgttcaccagtctgcctacaaataa

DBGET integrated database retrieval system