KEGG   Pantoea ananatis AJ13355: PAJ_0492Help
Entry
PAJ_0492          CDS       T01969                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
paj  Pantoea ananatis AJ13355
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:paj01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:paj00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:paj00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:paj00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603027..603374
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRATAILITLYIIYLLGFVVMTDTLTYDIWRGFFASAFTKVF
TLLTLFSILIHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcatccgcgttgggtcgcaatggcattcaggactggctgctgctgcgc
gcgacggcaatcctcatcacgctttacatcatctatctcctcggtttcgtggtgatgaca
gacacgctgacgtatgacatctggcgtggcttcttcgcttctgcatttacaaaagtgttc
acgctcctgacgctgttttccattctgatccacggctggatcggtatgtggcaggtctta
acggactacgttaaaccgctggcaacgcgtctgctgttgcagttggtcatcgtagtggcg
ctgttgtcatatgcaatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system