KEGG   Pantoea ananatis AJ13355: PAJ_0843Help
Entry
PAJ_0843          CDS       T01969                                 

Gene name
nagZ
Definition
beta-hexosaminidase NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paj  Pantoea ananatis AJ13355
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:paj00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:paj00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
998232..999272
Genome map
AA seq 346 aa AA seqDB search
MTTGFPGPLMLDVEGFELDAEEREILRHPLVGGLILFARNYHDPAQLAELVRQIRAASPT
RLVVAVDQEGGRVQRFRDGFTNLPAMQSFAALNDMTTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRAFHEDPAIALAMARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDGRSEAELREHDMAIFRTLIGEQALDAIMPAHVIYTEADPLPASGSPYWLKTVL
RQELGFKGVIFSDDLSMEGAAVMGSYAERAQQSLSAGCDMILVCNDRQGAVSVIDNLTVI
EAEPVVQLYHRGTFSRDSLKASRRWKQNAQQLSALQERWLAHKATW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggtttccccggccccttgatgctggacgtcgaaggtttcgaactggatgcg
gaagagcgtgagatactgcgccatccgctggtgggtggattaatccttttcgcccgcaac
tatcatgaccccgctcaactggccgagctggtgcgtcagattcgtgccgcctcgcctacg
cgcctggtggtggcggtggatcaggagggcgggcgagtacagcgttttcgtgatggcttt
acgaatttgcccgctatgcagtcttttgccgcgctcaacgatatgacaacggcaggcgag
ctggcacagcaggctggctggcagatggcggccgaaatgatcgcgctggatatcgatatc
agctttgcgccggtgctggatatcggccatatcagtgcggccattggcgatcgcgcgttc
catgaggaccctgcgattgccctggcgatggcgcggcgttttattgccggcatgcatgag
gccggaatgaaaaccaccggtaagcatttccccggtcacggcgcggtcagtgcagattcc
cacaaagagacaccgcgtgatggccgcagcgaagccgaactgcgcgagcatgatatggcg
atattccgcacgctgatcggcgagcaggcgctcgacgctattatgcccgcacacgtgatc
tatacggaagccgatccgctccccgccagcggttcgccttactggctgaaaacggtgtta
cgccaggagctgggtttcaagggcgtgattttctcggacgatctttcaatggaaggcgcg
gcggtgatgggcagctatgccgagcgtgcgcaacagtctctgtctgccggatgcgacatg
attctggtctgtaacgaccgtcagggcgcggtaagcgtgatcgataatttgaccgtgatc
gaggcagagccggtggtgcagttgtaccatcggggaacctttagccgggacagcctgaag
gccagtcgccgctggaaacagaatgcgcagcagttaagcgcgctgcaggaacgctggctg
gcgcataaagcgacgtggtaa

DBGET integrated database retrieval system