KEGG   Pantoea ananatis AJ13355: PAJ_0843Help
Entry
PAJ_0843          CDS       T01969                                 

Gene name
nagZ
Definition
beta-hexosaminidase NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paj  Pantoea ananatis AJ13355
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAJ_0843 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PAJ_0843 (nagZ)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAJ_0843 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
998232..999272
Genome map
AA seq 346 aa AA seqDB search
MTTGFPGPLMLDVEGFELDAEEREILRHPLVGGLILFARNYHDPAQLAELVRQIRAASPT
RLVVAVDQEGGRVQRFRDGFTNLPAMQSFAALNDMTTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRAFHEDPAIALAMARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDGRSEAELREHDMAIFRTLIGEQALDAIMPAHVIYTEADPLPASGSPYWLKTVL
RQELGFKGVIFSDDLSMEGAAVMGSYAERAQQSLSAGCDMILVCNDRQGAVSVIDNLTVI
EAEPVVQLYHRGTFSRDSLKASRRWKQNAQQLSALQERWLAHKATW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggtttccccggccccttgatgctggacgtcgaaggtttcgaactggatgcg
gaagagcgtgagatactgcgccatccgctggtgggtggattaatccttttcgcccgcaac
tatcatgaccccgctcaactggccgagctggtgcgtcagattcgtgccgcctcgcctacg
cgcctggtggtggcggtggatcaggagggcgggcgagtacagcgttttcgtgatggcttt
acgaatttgcccgctatgcagtcttttgccgcgctcaacgatatgacaacggcaggcgag
ctggcacagcaggctggctggcagatggcggccgaaatgatcgcgctggatatcgatatc
agctttgcgccggtgctggatatcggccatatcagtgcggccattggcgatcgcgcgttc
catgaggaccctgcgattgccctggcgatggcgcggcgttttattgccggcatgcatgag
gccggaatgaaaaccaccggtaagcatttccccggtcacggcgcggtcagtgcagattcc
cacaaagagacaccgcgtgatggccgcagcgaagccgaactgcgcgagcatgatatggcg
atattccgcacgctgatcggcgagcaggcgctcgacgctattatgcccgcacacgtgatc
tatacggaagccgatccgctccccgccagcggttcgccttactggctgaaaacggtgtta
cgccaggagctgggtttcaagggcgtgattttctcggacgatctttcaatggaaggcgcg
gcggtgatgggcagctatgccgagcgtgcgcaacagtctctgtctgccggatgcgacatg
attctggtctgtaacgaccgtcagggcgcggtaagcgtgatcgataatttgaccgtgatc
gaggcagagccggtggtgcagttgtaccatcggggaacctttagccgggacagcctgaag
gccagtcgccgctggaaacagaatgcgcagcagttaagcgcgctgcaggaacgctggctg
gcgcataaagcgacgtggtaa

DBGET integrated database retrieval system