KEGG   Pantoea ananatis AJ13355: PAJ_0968Help
Entry
PAJ_0968          CDS       T01969                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAJ_0968 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAJ_0968 (gpo)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAJ_0968 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157348..1157830)
Genome map
AA seq 160 aa AA seqDB search
MTTFHQLNATSLNGQHISMADYAGKLVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGSADDIAQTCHIHYGVSFPMFEKVEVNGPGTHPLFRYLKAELPGVLGE
RIKWNFTKFLIGRDGKPLKRFTPIATPEKMEATLLAALES
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttttcatcaactcaacgccaccagcctgaatggccagcacatctcgatggcc
gactatgctggcaagctggttctggtggtgaataccgccagccattgtggattcactcca
caatatgcaggtcttgaagcactctacaaaaagtacgctgcgcaggggctggtggtactg
ggtttcccttgcaaccagttcggtaagcaggaaccgggcagtgccgacgacatcgcgcag
acctgtcacattcactacggtgtgagcttccccatgttcgaaaaagtagaggttaacggc
cccggaacgcatccgctatttcgttacctgaaagcggagttacccggtgtgctgggtgag
cggattaaatggaacttcactaagtttttgatcggacgcgacggcaaaccactcaagcgt
tttacacccatcgctacgccggaaaaaatggaagccaccctcctggcggcacttgaaagc
taa

DBGET integrated database retrieval system