KEGG   Pantoea ananatis AJ13355: PAJ_1051Help
Entry
PAJ_1051          CDS       T01969                                 

Gene name
btuE
Definition
vitamin B12 transport periplasmic protein BtuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAJ_1051 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAJ_1051 (btuE)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAJ_1051 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259526..1260071
Genome map
AA seq 181 aa AA seqDB search
MSIYQTELVTLDGEKTALSSWQGQVLLVVNVASKCGLTPQYEALENIHKAWHEQGFSVLG
FPCNQFLEQEPGSSEEIKTFCSTTYGVTFPMFEKCEVNGEHRHPLYAQLVAAKPEAVRPE
ESGFYERMVSKGRAPKAPGDILWNFEKFLIGRDGSVIQRFSPDMSPEDPIILETIKQALA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatcaaactgaactggttacactggatggtgagaaaacggcgctgtcctcc
tggcagggacaggtgctgctggtggtcaacgtggcctctaaatgcggcttaaccccacaa
tatgaagcgctggaaaatattcataaagcctggcatgagcagggcttcagcgtgctgggt
ttcccctgcaaccagtttctggagcaggagccaggcagtagcgaagaaatcaaaacgttt
tgcagcacgacctacggtgtgacgtttccgatgttcgaaaagtgtgaggtcaatggtgag
catcgtcatccgctttatgcacagctggtcgcggcgaaacccgaggccgtgcgtccggaa
gagagtggtttttatgagcgcatggtcagcaaaggacgggctcccaaagcgccgggcgat
attctgtggaacttcgaaaaattcctgatagggcgtgatggcagcgttattcagcgtttc
tcaccggacatgtcgccagaagatcccattattctggaaacgatcaaacaggcgctggca
aagtaa

DBGET integrated database retrieval system