KEGG   Pantoea ananatis AJ13355: PAJ_1193Help
Entry
PAJ_1193          CDS       T01969                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00030  Pentose phosphate pathway
paj00051  Fructose and mannose metabolism
paj00052  Galactose metabolism
paj00680  Methane metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
paj01230  Biosynthesis of amino acids
paj03018  RNA degradation
Module
paj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_1193 (pfkA)
   00030 Pentose phosphate pathway
    PAJ_1193 (pfkA)
   00051 Fructose and mannose metabolism
    PAJ_1193 (pfkA)
   00052 Galactose metabolism
    PAJ_1193 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PAJ_1193 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAJ_1193 (pfkA)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAJ_1193 (pfkA)
Protein phosphatases and associated proteins [BR:paj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAJ_1193 (pfkA)
Messenger RNA biogenesis [BR:paj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAJ_1193 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: BAK11273
UniProt: A0A0H3KW46
Position
1433278..1434258
Genome map
AA seq 326 aa AA seqDB search
MRIGMVISGGDVTGINNFIFQIARMTQAEMILFNGGIPGLLDNVCQEISQRDLVDFSITS
LPVMQSGRTARKLIRSEYETIARQLKALRIDVLILAGGDGSLQFLHTLSEFGVNCFGIGM
TIDNDVYGSDYTVGFSTACEQVLKEVAKLRNTGRALTGRVFMVELLGGYCGELTLQSALK
SNADFALIPECQIPTNVLAERITQRLSEQNSVVILCSEGYTREYSPGFQGAIDTLIKQLE
PLIGVRIRKTIVGYGLRNGDPTCEEIYQGTIMASEVVRCIQSGMRNKAVIINGSNKPIPI
DLISMKKRLVDTEGHHYKLAKQLHIL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggaatggtcattagcggcggcgacgtcaccggcattaataatttcattttc
cagatagccaggatgacgcaggcggagatgatattatttaacggcggcattccaggcttg
ctggataatgtctgccaggaaatttctcagcgcgatttagtggatttttccattacttct
cttccggtaatgcagtcaggccgaaccgcgcgaaaattaattcgtagcgaatatgaaacg
atcgcccggcagttaaaagcattacgcatcgacgtattaattctggctggaggcgacgga
tcgctgcaatttctgcatacgctcagtgaatttggtgtgaactgttttggcatcggcatg
acgattgacaacgatgtctacggcagtgattacaccgtgggcttttccaccgcctgtgag
caggtattaaaagaggtggcaaagctcagaaacaccggtcgggcattaacgggccgggta
tttatggtggaactgctcggcggctactgtggcgaattgacgctccagtcagcgctcaaa
tccaacgccgactttgcgctgatcccggaatgccagatccccacaaacgtgctggcagaa
cgcatcactcagcgcctcagcgaacaaaacagcgtggtaatcctctgctcagaaggttac
acacgggaatattcaccgggctttcagggggcgattgacacattaattaagcagcttgaa
ccgttgatcggcgtgcgcattcgcaaaacgatcgtcggctatggactgcgaaatggcgat
cccacctgtgaggaaatttatcagggcaccattatggcaagtgaagtggttcgttgtatt
caatccggaatgcgcaataaagccgtgattattaacggcagtaataagcctattccgatt
gacttaataagcatgaaaaaacgcctggtcgatacagaagggcatcattataaactcgct
aaacaactgcatatattgtga

DBGET integrated database retrieval system