KEGG   Pantoea ananatis AJ13355: PAJ_1245Help
Entry
PAJ_1245          CDS       T01969                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAJ_1245 (malQ)
Enzymes [BR:paj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAJ_1245 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488798..1490849)
Genome map
AA seq 683 aa AA seqDB search
MKPLHYPAGIGRVATEYVDAHGAVRQVSASTRDRLLAAMQPGPGPGVIPPVAVFTQGLPI
RLTPSLAGPARWHLEGESGERWSGHCEPEASLTLPALPEGYHLLTINADAQQSRCQIIVT
PSRCYEPEALLRGERRWGTCVQLYALRSDQNWGIGDFADLRDMVKAVGMRGGAFVGLNPL
HALFPALPDDASPYSPSSRRWLNVLYISVPEVEDFNLSAAAQCWWQSDETQHRLHQARHA
PWVDYSTVASLKLDALRFAWQQFMQRDKEDSQVEAFEAFVAEGGESLLHQGLFDALQAWL
REEDPLRHGWQTWPTAYQQPDTAAVHAFRIENGDEIRFYLWLQWLAARQFAACWHLCQQH
QMAPGLYRDLAVGIAAGGSETWSQRGLYCLAASTGAPPDILGPLGQNWGLPPMDPQSLYD
RAYEPWITLLRANMRDCGALRIDHVMALLRLWWIPQGETAAAGAYVAYPIDDLLAILALE
SQRQRCMVIGEDLGTVPEAIVDKLHNAGVYSYKVLYFEQNSHKGFRPPAAWPRQAMAVAT
THDMPTLRGWWQSDDLTLGSQLGLYPDKAVLAGLYHQRRAARSALLQTLTRHGYLKPKGR
VQANSPRMSLLLNQVIHQYLADCTSALLGLQPEDWLDMASPVNVPGTVEAYPNWRRKLNL
SLEAMFADKRITALLEEISRRYS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcattatccggccgggatcggcagggtagccactgaatatgttgatgcg
catggggcggtccggcaggtttctgcatcgacccgcgatcgcttgctggcggcgatgcag
ccgggccctggccctggcgttatcccaccggtcgccgtctttacccagggtttgcccatc
cgtttaacgccctctctggctggcccggcacgctggcacctggagggcgaatcgggtgaa
cgctggtcagggcactgcgagcctgaggcgtctttgacgctcccggcgctgcctgaaggt
taccatcttctgacgataaacgcggatgcacagcaatcgaggtgccagataatagtgaca
ccgtcacgttgctatgagccggaggccttgctacggggcgagagacgctggggaacctgt
gtccagctctacgctttacgatcggatcagaactggggaatcggcgattttgctgacctg
cgggacatggtgaaggcggttggcatgcgcggcggcgcttttgtggggctgaatcccctg
catgcgctttttcctgcgttacctgatgatgccagcccctatagcccgtcttcccggcgc
tggctcaacgtgctctatatcagcgttcctgaggttgaggactttaacctgagtgccgct
gcgcagtgctggtggcagtcggatgaaacgcaacacaggctgcaccaggcgcgtcacgcg
ccctgggtcgattattcgacggtggcatcacttaagctggatgccctgcggtttgcctgg
cagcagtttatgcagcgtgataaagaggatagtcaggtcgaggcatttgaggcgtttgtg
gctgagggcggtgaaagtctgctgcatcagggattgttcgatgccctgcaggcctggctt
cgcgaagaagatcccctgcgtcacggctggcaaacgtggcccactgcctatcaacaaccc
gatacggccgccgtacacgcgtttcggattgaaaatggcgatgagattcgtttctatctc
tggctgcaatggctggcggcgcgtcagtttgccgcctgttggcacctgtgccagcagcac
cagatggcacctggactttatcgcgatttggccgttggcatcgccgcagggggatcggaa
acctggagccaacgcgggctttactgtttagcggccagcacaggcgccccgccggatatt
ctgggcccgcttggccagaactgggggctgccgccaatggacccgcaatctttgtatgat
cgggcatatgaaccctggattacgttgctgcgtgcgaatatgcgcgattgtggggcgtta
cgtatcgatcatgtcatggctttgctgcgactgtggtggattccgcaaggagaaacggcc
gccgcaggcgcgtatgtcgcctatcccattgacgacctgctcgctattctggcgctggaa
agtcagcgccagcgctgcatggtgattggtgaggatttaggcacggtgccggaggcgatt
gtcgataaactccacaatgctggcgtctactcgtataaggtgctctattttgagcaaaac
tcgcacaagggctttcgcccacctgcggcatggccgcgtcaggcaatggctgtagccacc
actcacgatatgccaacgctccgtggctggtggcaaagtgacgatctgacactggggagc
caactggggttgtatcctgataaagcggtgcttgccgggctgtatcatcagcgccgggca
gcccgatcggcgctgcttcagaccctgacgcgccacggttacctcaagcccaaagggcgg
gttcaggcaaacagtccgcgcatgagtctgttacttaaccaggttatccatcagtatctc
gcggactgcaccagcgccctgctgggtttacaacccgaagactggctggatatggcctcg
ccggttaatgtgccgggcacggtagaggcttatccgaactggcggcgtaagctaaacctg
tcgctggaggcgatgtttgcagataagcgtatcacggcattgctggaggagatttcccgg
cgttattcgtga

DBGET integrated database retrieval system