KEGG   Pantoea ananatis AJ13355: PAJ_1392Help
Entry
PAJ_1392          CDS       T01969                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAJ_1392 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAJ_1392 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAJ_1392 (trpB)
Enzymes [BR:paj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAJ_1392 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1687579..1688769
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGDFGGMYVPQILMPALKQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTL
CSNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEGRLPDAVIACVGGGSNAIGMF
ADFIDEEKVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDNEALAAFKTLCRAEGIIPALESAHALAHALRM
IKAEPEKEQLIVVNLSGRGDKDIFTVHDILTAQGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacttaatccctattttggcgacttcggcggcatgtatgtgccgcagattttg
atgccggccttgaaacagctagaagaagcttttgtcagcgcgcaaaaagatccggaattc
caggctgaatttaccgatctgctgaaaaattatgctggccgccccacagccttaaccctg
tgcagtaatctgaccaaagggtcgaaaacccgcctgtacttaaagcgcgaagacctgttg
cacggcggcgcgcacaagaccaaccaggtgttagggcaggctctgctggctaagcgcatg
ggcaaaaacgaaatcattgccgaaaccggtgcaggccagcatggcgtcgcctctgccctt
gcctgcgcgctgctgggcatgaaatgtcgcatctatatgggcgccaaagacgtagagcgg
cagtcgccgaacgtctttcgtatgcgcctgatgggcgccgaggtcatcccggtgcacagc
ggctctgccacattgaaagatgcctgcaacgaagcgctgcgcgactggtcaggcagttat
gaaaccgctcactatatgctgggcaccgcggcgggtccgcacccgttcccgacgattgtg
cgtgagtttcagcgcatgattggtgaagagaccaaaaagcagattctggaaaaggaaggt
cgcctgccggatgccgtgatcgcctgcgtcggcgggggctccaacgccatcggtatgttt
gccgactttatcgacgaagagaaggtgaagctgattggtgttgaaccggccggacacggg
attgaaaccggcgaacacggtgcgccactgaagcacggccgcgtcggcatttacttcggt
atgaaagccccgatgatgcagactgacgaagggcagattgaagagtcatactcaatttca
gccggactcgactttccttctgtcggtcctcagcacgctcacctcaacagtattggtcgg
gctgactatgtttcggtaaccgacaatgaagcgcttgctgcctttaaaacgctgtgccgc
gccgaaggtatcattcctgccctggagtcagcgcacgcgctggcccacgcgctgagaatg
attaaggcagaacccgagaaagagcagttgattgtcgtcaacctttcgggtcgcggtgat
aaagatatcttcaccgtccacgatattctgactgcgcagggagaaatctga

DBGET integrated database retrieval system