KEGG   Pantoea ananatis AJ13355: PAJ_1393Help
Entry
PAJ_1393          CDS       T01969                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAJ_1393 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAJ_1393 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAJ_1393 (trpA)
Enzymes [BR:paj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAJ_1393 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1688769..1689572
Genome map
AA seq 267 aa AA seqDB search
MERYDRLFSRLAEKKEGALVPFVTLGDPSPEMSLRIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFAAGTTTAQCFEMLAAIRHKYPELPVGLLMYANLVFSNGIDEFYARCAQ
AGIDSVLVADVPVEESAPFRQAAMRHGIAPIFICPPNASDELLREIASHGRGYTYLLSRA
GVTGTEKRASLPLDHLIAKLREYHAAPPLQGFGISEPSQVRESLGAGSAGAISGSAVVKI
IEQHQAEPEVMLDALRTFIGNLKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgatcggctgttttcacgtctggcagagaagaaagaaggtgcactggtg
cctttcgttacgctgggcgatccgtcacccgaaatgtcattacgaattattgatgcgctg
gtagaaggtggtgcagatgcgcttgaactgggtattcccttttcagatccgctagcggat
ggtccgacaattcaaagcgcaacgctgcgcgcctttgctgcgggcaccaccacagcacag
tgctttgaaatgcttgctgcgatccgtcataagtaccctgaattacctgttggcttactc
atgtacgccaaccttgtgttcagcaacggcattgatgaattttatgcccgctgtgcccag
gccgggattgattcggttctcgtggcagatgtgcccgtggaagagtccgcgccgttccgt
caggccgctatgcgtcacgggattgcgcccattttcatttgccctcccaacgccagcgat
gaactactccgtgaaattgcctctcacggccgcggttatacctatctgctgtcacgcgct
ggggtgaccggtaccgagaagcgggccagcctgccgctggaccacctgattgcaaaatta
cgggaatatcatgcagcgccgccgctgcagggctttggcatttctgaaccctcgcaggtt
agagaatctctcggtgcgggctccgccggtgcgatctcaggttcggccgtggttaaaatc
attgaacaacatcaggcagaacccgaagtgatgctggatgccctgagaacctttattggt
aacctcaaagccgccacccgctaa

DBGET integrated database retrieval system