KEGG   Pantoea ananatis AJ13355: PAJ_1411Help
Entry
PAJ_1411          CDS       T01969                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase AdhE
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PAJ_1411 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_1411 (adhE)
   00620 Pyruvate metabolism
    PAJ_1411 (adhE)
   00650 Butanoate metabolism
    PAJ_1411 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PAJ_1411 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAJ_1411 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAJ_1411 (adhE)
   00626 Naphthalene degradation
    PAJ_1411 (adhE)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAJ_1411 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PAJ_1411 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1706103..1708790
Genome map
AA seq 895 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFANFSQQQVDAIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLDTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDAPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADVKRAVASILMSKTF
DNGVICASEQSVIVVDAVYDAVRERFASHGGYLLQGQELSAVQNIILKNGGLNAAIVGQP
AVKIAEMAGISVPGETKILIGEVERVDESEPFAHEKLSPTLAMYRAKDYQDAVSKAEKLV
AMGGIGHTSCLYTDQDNQTARVHYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEIATDGAK
RAFVVTDRFLFNNGYADQVTRVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKARMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPRSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANSLLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLTATGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDKLADDAFDDQ
CTGANPRYPLIAELKQLMLDSYYGRKFVEPFASAAEAAQAQPVSDSKAAKKAKKA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggccgttactaatgtcgctgaactcaatgcactggttgaacgtgtaaaaaaagcccag
caagaattcgccaatttttctcaacaacaggtcgatgccatcttccgcgcagccgcactg
gccgccgcggatgcccgaattccactcgctaaaatggcggtggcggaatcgggcatgggc
attgttgaagacaaagtcattaaaaatcacttcgcttctgaatacatctacaacgcctat
aaggatgagaaaacctgcggcgtactggacaccgatgatacgtttggcaccatcaccatc
gctgaacccatcggcctgatttgcggtattgtccccaccactaaccctacctcgaccgca
atttttaaggcacttatcagccttaaaacccgcaacgggattatcttctccccccatcct
cgagccaaagatgcgacgaacaaagcggcggatattgtcctgcaggcagcgattgccgct
ggcgcgcccaaagacattataggctggattgatgcaccttctgtggaactgtccaatcag
ttgatgcaccatcctgatattaacctgattctggcgacgggtggccccggcatggtcaaa
gccgcctacagctcaggtaagccggcgattggcgtgggggccggtaacacgcccgttgtc
atcgatgaaacagctgatgttaaacgcgccgttgcctccatcctgatgtcaaaaacgttt
gataacggtgtgatctgtgcctctgaacagtcggttatcgtggtggatgccgtctacgac
gccgtgcgcgagcgcttcgccagccatggtggctatttgcttcagggacaggagctgagt
gcggtacaaaatatcattctaaaaaacggtgggcttaacgccgccattgtgggccagcct
gcggtgaagattgcggagatggccggcatcagcgtacctggtgaaaccaaaatcctgatt
ggcgaagttgaacgggtcgatgaatcagaacctttcgctcatgaaaaactgtcgccgaca
ctggcgatgtaccgtgctaaagattatcaggatgccgtcagcaaagcggagaaactggtg
gcgatgggcggtattggtcatacgtcatgcctgtataccgaccaggacaatcagacagcg
cgcgtgcactattttggcgacaagatgaaaacagcccgcattctgatcaacacgccagct
tctcagggcggtattggtgatttatataacttcaaactcgccccttctctgacactgggt
tgtggttcctggggcggtaactccatttctgaaaacgtggggcccaaacatctcatcaac
aagaaaaccgtcgctaagcgagctgaaaatatgttgtggcataaacttccgaagtccatt
tactttcgtcgcggctctttacccattgcgcttgaagagatcgccactgacggtgccaaa
cgcgcgtttgtggtgactgaccgcttcctgtttaacaacggttatgccgatcaggtcacc
cgcgttttaaaatctcacggcatcgaaaccgaagttttctttgaggttgaagcggatccc
accttaagcatcgtgcgtaaaggtgcagaacagatgaacagctttaagccagacgtgatc
atcgccctgggcggcggttcgccgatggatgcagccaaaatcatgtgggtcatgtatgag
catccagaaacccattttgaagagctggcactgcggtttatggatattcgcaaacgtatc
tataagttccctaaaatgggcgtgaaagcgcgcatggtggccattacgacaacctcaggc
acaggttcagaagtgacgccttttgccgtggtaacggatgacgcgaccggacagaaatac
ccgctggccgattatgcgctgacgccggatatggctatcgttgatgccaacctggtcatg
gatatgccacgttcactttgtgccttcggcggtctggatgcggtgacgcacgcgctggaa
gcctatgtgtccgttctggccaatgaatactccgatggtcaggccctgcaggcgcttaag
ctgcttaaagagaacttaccggcgagttatgcagaaggtgcaaaaaatccggttgcccgt
gaacgtgtacataatgccgccaccatcgccggtatcgcctttgctaacgccttcctcggg
gtttgtcactcaatggcgcataagcttggctctgagttccatattcctcatggactggct
aactcgctgctgatttccaacgttattcgctataacgccaatgacaaccctactaagcaa
accgcattcagccagtacgatcgtccccaggcgcgtcgtcgttatgctgaaattgcggat
catcttggtctcaccgcgacgggcgaccgcactgcccagaaaattgagaagctgctggta
tggctggatgagatcaaaacggaactgggtattccggcatcgattcgtgaagccggtgtg
caggaggcagacttcctggcgaaagtcgataaactggcggatgatgcctttgatgaccag
tgtactggcgcgaatccacgttatccgctgattgccgaactcaaacagctgatgctggac
agctactacggacgcaaatttgtcgagccgttcgccagtgccgccgaggctgcccaggct
cagcctgtcagtgacagcaaagcggcgaagaaagctaaaaaagcctaa

DBGET integrated database retrieval system