KEGG   Pantoea ananatis AJ13355: PAJ_1416Help
Entry
PAJ_1416          CDS       T01969                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1416 (galU)
   00052 Galactose metabolism
    PAJ_1416 (galU)
   00500 Starch and sucrose metabolism
    PAJ_1416 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PAJ_1416 (galU)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAJ_1416 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1712950..1713858)
Genome map
AA seq 302 aa AA seqDB search
MSAYKTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAVM
CAHPLVGDEPVAVILPDVIIDEYESNPTKDNLAEMLSRYEESGRSQIMVEPVSDVTAYGV
VDCQGAELNPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEVQ
LTDSIAMLMDKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKEFTEWLNNTVSD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataagaccaaagtaaaaaaagcggtaattccagtagcgggtttgggtaca
cgtatgttgcctgctaccaaagcgattccaaaagaaatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgcgggtattaatgagattgtgctggtt
actcactcctctaaaaacgccattgagaaccattttgataccagttttgaactggagtct
atgctggaaaaacgcgtcaagcgccagctgctggacgaaattcagtccatctgtcctcct
cacgtgaccatcatgcaggtccgtcagggcatcgcgaaaggtctgggccatgcggtcatg
tgtgcacatcctctggtcggcgatgaacctgttgcggtcatcctgcctgacgtgatcatc
gacgaatacgaatctaacccaaccaaagataacctggcagaaatgctgagccgttacgaa
gagtctggccgtagtcagatcatggttgagcccgtcagcgatgtgacggcatacggtgtt
gtggattgtcagggtgcagaactgaatcctggtgacagcgcgcctatggtcggggttgtt
gagaaacctaaagcgtctgaagcgccatccaaccttgcggttgtcggtcgttacgttctg
tctgcggatatctggccactgctggcgaaaacgcctccaggtgccggtggcgaagttcag
ctcaccgactccatcgccatgctgatggataaagaaaccgtcgaagcctatcacctgaaa
ggggtaagccacgactgtggtaacaaactgggttatatgcaggctttcgttgaatatggt
gtccgccatccggtattgggtaaagagttcactgaatggctcaacaatactgttagcgat
aaaaagtaa

DBGET integrated database retrieval system