KEGG   Pantoea ananatis AJ13355: PAJ_1428Help
Entry
PAJ_1428          CDS       T01969                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAJ_1428 (pncA)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PAJ_1428 (pncA)
    3.5.1.-  
     PAJ_1428 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1725500..1726108
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVREGDHTVAVANRYARAFHEKGECVVALQDWHPANHGSF
ASVSGEPVYTLGELNGLPQIWWPDHGVQHSAGADFHPGLDRSLFDAVFHKGQDQDVDSYS
AFFDNGHRRKTELDSWLRERGISHLVMLGLATDYCVKYSVLDALELGYQVDVVAEGCRGV
NLNPEDSDIALAQMAAQGAVIV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcactgatcattatcgatattcagaacgacttctgccccggcggcccaatg
gccgtgagagaaggcgatcacaccgtcgcggtagcaaatcgctatgcccgtgcctttcat
gagaaaggcgaatgcgtagtggccttgcaggactggcacccggccaatcatggcagcttt
gcttctgtctcgggcgagccggtttataccctgggtgagctcaacggtttgcctcaaatc
tggtggcccgatcatggtgttcagcattcggcgggcgctgattttcatcctggtctcgat
cgcagcctgtttgatgctgtttttcacaagggccaggatcaggatgtcgacagctacagc
gctttttttgataacggccatcgccgtaaaacggagctggacagctggttacgtgaacgc
ggcatcagccatctggttatgctggggctggcaaccgattactgtgtgaaatacagcgtt
ctggatgcactggaactgggctatcaggtggacgtggtcgccgaaggctgccgcggggtg
aatttgaatcctgaagacagcgacatcgcactggcccagatggccgcccagggtgcggtc
attgtctga

DBGET integrated database retrieval system