KEGG   Pantoea ananatis AJ13355: PAJ_1579Help
Entry
PAJ_1579          CDS       T01969                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase RfbC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:paj00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:paj00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1899895..1900428
Genome map
AA seq 177 aa AA seqDB search
MKVKATKIADVKIIQPAVYGDDRGFFLETFEKRRYQELLETHLEFVQDNYSRSGRHVLRG
LHFQKTEPQGKLVRVVRGEVFDVAVDIRPGSPTFGQWESILLSEENKTQLWIPPGLAHGF
VVLSDVADFEYKCTQYYNPKDEACLMWNDPDVAIQWPVEQPILSVKDQQGLSLQELV
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcaaagccactaaaattgccgatgttaaaatcatccagccagcggtttatggt
gacgatcgtggttttttcctggaaacgtttgaaaaacgtcgctatcaggagttacttgaa
acccacctcgaatttgtgcaagacaactattcgcgctcaggccgacatgtattacgcggc
ttacattttcagaaaacagagccccagggcaagctggtgcgcgtcgtgcggggcgaagta
ttcgatgttgcagtcgacatccgtcccggttctccgacctttggtcagtgggagagtatt
ctgctttctgaagaaaataaaacgcagctgtggattccccccggactcgcgcacggtttt
gtcgtcctttcggacgtcgctgactttgaatacaaatgtactcaatattacaaccctaag
gatgaagcctgcctgatgtggaatgaccctgatgttgcaattcaatggcctgtagaacag
ccgatattgtcggtaaaagatcaacaaggactatcactgcaggagttggtgtaa

DBGET integrated database retrieval system