KEGG   Pantoea ananatis AJ13355: PAJ_1788Help
Entry
PAJ_1788          CDS       T01969                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1788 (galF)
   00052 Galactose metabolism
    PAJ_1788 (galF)
   00500 Starch and sucrose metabolism
    PAJ_1788 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    PAJ_1788 (galF)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAJ_1788 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2154708..2155604)
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQAQPLGLGHSILCARPM
IGDNPFVVVLPDVLLDDSTADHLRYNLAAMVARFEETGHSQVLAKHLTDYDLSEYSVITT
EQPLENPGDVSTITDFVEKPEHPAELNSDLAAVGRYVLSADIWAELERTEPGAWGRIQLT
DAIASLSKKKTVDVSLMTGHSFDCGRKMGYMQAFVSYGLRNNAQGRDFREAIEKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagtaatcccggttgcgggtctcggtatgcatatgcttccggcg
actaaagccattccgaaagagatgctgcctgtcgtggacaagccaatgattcaatacatc
attgatgagtgtgttgcagcagggatcaaagagattgtgctggtcacccatgcgtccaag
aatgcggtagaaaaccacttcgataccacctatgaactcgaagccctgctggaagcacgc
gttaaacgccagctgctgagtgaagtccagtcaatctgcccgccgggcgtgaccatcatg
aacgtgcgtcaggcgcagccactgggcctggggcattctattctctgcgcgcgtccaatg
atcggcgacaatccttttgtggttgtcctgcctgacgtgctgttggacgattccaccgct
gaccatttacgatataatctggcggcgatggttgcgcgttttgaagagactggtcacagc
caggtgctggcaaaacacctcaccgactacgatctgtctgaatactcagtgatcacgact
gagcagccgctggaaaacccaggtgatgtcagcacgattactgacttcgttgagaaacct
gagcatccggccgagttaaactcagacctggcagcggtgggacgctacgtgctttcagcc
gatatctgggctgagctggagcgtaccgaaccgggcgcatggggccgtattcagttaacg
gatgctatcgccagcctgagtaagaagaaaacggtcgatgtctcactcatgacgggtcac
agtttcgactgcggacgtaaaatgggttacatgcaggcatttgtctcctacggtctgcgc
aataacgctcagggccgcgacttccgcgaagcgatcgagaaaattctggcgaagtaa

DBGET integrated database retrieval system