KEGG   Pantoea ananatis AJ13355: PAJ_1838Help
Entry
PAJ_1838          CDS       T01969                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I FolE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00790  Folate biosynthesis
paj01100  Metabolic pathways
Module
paj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAJ_1838 (folE)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PAJ_1838 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: BAK11918
UniProt: A0A0H3KXY7
Position
complement(2222584..2223249)
Genome map
AA seq 221 aa AA seqDB search
MSTLSQEAALVHEALLARGLETPLRAPTREIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEVFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQVLLALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgagtcaggaagctgcactggtccacgaagcgctgctggcgcgtgggctg
gaaacgccgctgcgcgcacccacgcgtgaaatagacgatgaaacgcgtaagagcctgatt
gcaggccatatgacggaaatcatgcagctgctgaatctggatcttgaagatgacagcctg
atggaaaccccgcatcgcatcgccaaaatgtatgtcgatgaggtcttttccggtctcgat
tatgccaacttccccaaaatcacgctcatcgaaaacaagatgaaagtggatgagatggtg
acggttcgcgacattacgctgaccagcacctgcgaacatcattttgtgattatcgacggg
aaagccaccgtcgcgtatatccctaaagataaggtgatcggcttatccaagatcaaccgc
atcgtgcagttcttcgcgcagcggcctcaggtgcaggagcgtttaacacagcaggtcctg
ctggcgctgcaaacgctgttgggaacgaataacgttgccgtttcgatcgatgccgttcac
tactgtgtgaaagcgcgcggcgtgaaggatgccaccagcgccacgaccacgacctcgctg
ggtgggctgtttaaatccagtcaaaatacccgtcaggaattcctgcgcgcggtgcgtcat
aactaa

DBGET integrated database retrieval system