KEGG   Pantoea ananatis AJ13355: PAJ_2028Help
Entry
PAJ_2028          CDS       T01969                                 

Gene name
glk
Definition
(GenBank) glucokinase Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00052  Galactose metabolism
paj00500  Starch and sucrose metabolism
paj00520  Amino sugar and nucleotide sugar metabolism
paj00521  Streptomycin biosynthesis
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
Module
paj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_2028 (glk)
   00052 Galactose metabolism
    PAJ_2028 (glk)
   00500 Starch and sucrose metabolism
    PAJ_2028 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PAJ_2028 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAJ_2028 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PAJ_2028 (glk)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAJ_2028 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: BAK12108
UniProt: A0A0H3KYG9
Position
complement(2460212..2461177)
Genome map
AA seq 321 aa AA seqDB search
MTTYALVGDVGGTNARLALCEVENGSISQAKTFATSDYDSLEAVIRHYLDEQKQDIKDGC
IAIACPITDDWVEMTNHDWAFSTKKLKENIGFEHLEIINDFTAVSMAIPMLGAEHVIQFG
GKEPIKDKPVAIYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAANSEEEDQILEVLREE
LGHVSAERVLSGAGLVNLYRAIVKVDHRVPENLKPKEVSERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKSSGFRAAFEDKGRFRDYVATIPVYMIT
HDQPGLLGAGAHLRQTLGRII
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatgccttggtcggcgatgtcggcggcaccaatgcccgtctcgctttgtgt
gaggtggaaaacggcagcatctcccaggccaaaacattcgcaacatcagactacgacagc
ctcgaagccgtcatccgccactatcttgatgaacaaaagcaggatatcaaagacggttgt
atcgccattgcctgcccgattaccgatgactgggttgagatgaccaaccacgactgggca
ttttcgaccaaaaagctgaaagaaaacatcggttttgaacacctggaaattattaacgac
ttcacagcggtttccatggccatccctatgctgggtgcggaacatgtcattcagtttggt
ggcaaagagccgatcaaggataagcctgtggccatttacggcgcgggtaccgggctgggc
gtgagtcatctggtccatgttgataagcgttgggtcagtctgcccggcgaaggcggccac
gttgactttgcggccaacagcgaagaagaagatcaaatcctcgaagtgttgcgggaagag
ctaggccatgtgtcggccgagcgcgttctgtccggcgcggggctggtcaatctctatcgg
gcgattgtgaaagtcgatcatcgcgtacccgaaaatctcaagcccaaagaagtgagtgag
cgtgcgcttgctgacagctgcaccgactgccgtcgtgcactgtcgctgttctgcgtgatt
atgggacgtttcggcggtaacctggccctgaaccttggcaccttcggtggagtgtacatc
gcgggcggtatcgtgccgcgcttcctggagttcttcaaatcgtcgggcttccgggcggcc
ttcgaagacaaagggcgctttcgcgattatgtcgccacgattccggtctatatgatcacc
cacgatcaacccggactattaggcgctggcgcgcacctgcgccaaacgctgggccgcatt
atctaa

DBGET integrated database retrieval system