KEGG   Pantoea ananatis AJ13355: PAJ_2413Help
Entry
PAJ_2413          CDS       T01969                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2911578..2913005
Genome map
AA seq 475 aa AA seqDB search
MSLPKTFLWGGAVAAHQVEGGWDQGGKGISIADVLTGGAHGVDRVITDGVQPGKFYPNHQ
AVEFYSHYKQDIALFAEMGFKCFRTSIAWTRIFPNGDEPQPNEAGLQFYDDLFDELLKYG
IEPVITLSHFEMPYHLVKEYGGWHNRKVVDFFVRFSEVVLKRYKNKVKYWMTFNEINNQR
NWQYPLFGYCCSGVIFTEHEKPEQAMYQVMHHQFVASAKVVKLGHEINPEFKIGCMIAMV
PVYPFSCHPDDVMLAQEAMHQRYVFSDVQMRGYYPAYALKEWARKGYHIDMEPEDAETLR
NGCADYVGFSYYMSTAVQTRASGVDDPITGFEGTVKNPHVKASDWGWQIDPVGLRYVLND
VYERYQKPLFIVENGFGAIDKPNAQGVIEDDYRIDYLAAHIEEMKKAVIHDGVDLMGYTP
WGCIDCVSFTTGQYNKRYGFIHVNKNDDGSGDFSRSRKKSFAWYQQVIASNGEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaccaaaaacgtttctgtggggcggcgcggtcgcggctcatcaggtagagggc
ggctgggatcagggcggtaagggcatcagtattgctgatgtactgaccggcggcgctcat
ggcgtggaccgcgtcatcaccgacggcgtccagccaggaaaattctatccaaatcatcag
gctgttgaattttattctcattacaaacaggatatcgcgctgtttgctgagatgggattt
aaatgcttccgtacctcaattgcctggacccgtattttccctaacggcgatgaaccgcaa
cccaatgaagccggcctgcaattctatgacgacctgtttgatgaattgcttaaatacggt
attgagccggttattaccctctcccattttgaaatgccctatcacctggtaaaagaatac
ggtggctggcacaatcgtaaggttgtcgatttctttgtgcgctttagtgaagttgtgctg
aagcgttataagaataaagtgaaatactggatgacctttaacgaaattaacaaccagcgt
aactggcaatatccgctgtttggttactgctgctcaggcgttattttcacggaacatgaa
aaacctgaacaggcgatgtatcaggtcatgcatcatcagtttgttgccagcgccaaagtc
gtgaagctgggccacgagattaacccggagtttaagattggctgcatgatcgccatggtg
ccggtctatcccttctcctgccatccggatgacgtcatgctcgctcaggaagcgatgcat
caacgctatgtctttagcgacgtgcagatgcgcggttactacccggcttacgccctgaaa
gagtgggcgcgcaaaggctatcatatcgacatggagcctgaagacgctgaaaccctgcgc
aatggctgtgccgactatgtgggcttcagttattacatgagtacagccgttcagacccgc
gccagtggcgttgatgatcctattaccggcttcgaaggcacggtgaaaaatccgcacgtt
aaagcctcagactggggctggcagatcgatcctgttggtctgcggtatgttcttaatgat
gtgtatgaacgctatcagaaacccctgtttattgttgaaaacggttttggcgccatcgac
aaaccgaatgcgcagggcgtgatagaggatgattaccgcattgattatctggccgcgcat
attgaagagatgaaaaaagccgtcattcatgacggggtggatctcatggggtacacgccc
tggggctgtatcgactgcgtgtctttcactaccggtcagtacaacaagcgttacggtttt
attcacgtgaataaaaacgatgacggcagtggagacttctcgcgctccaggaaaaagagt
tttgcctggtatcaacaggtcatcgccagcaatggtgaaaagctgtaa

DBGET integrated database retrieval system