KEGG   Pantoea ananatis AJ13355: PAJ_2459Help
Entry
PAJ_2459          CDS       T01969                                 

Gene name
melA
Definition
alpha-galactosidase MelA
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:paj00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:paj00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:paj00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2962177..2963580
Genome map
AA seq 467 aa AA seqDB search
MNGVTFWRYPTLQWSVLMSAPKITFIGAGSTIFVKNILGDVFHRDALKSAHIALMDIDAT
RLEESFTVVSKLMSSAGAAGRITCHTDQKAALADADFVVVAFQIGGYEPCTLTDFAVCKR
YGLEQTIADTLGPGGIMRALRTIPHLWQICEDMTAVCPDATMLNYVNPMAMNTWAMYARY
PHIKQVGLCHSVQGTAEELAYDLNLNPADLRYRSAGINHMAFYLELERKTADGAYVNLYP
ELLAAFDAGQVPKPNMHGNTRCPNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDL
IARYQIPLDEYPKRCVEQLDNWRTELEHYKRAERIESKPSREYASAIMNAIWTGEPAVIY
GNVRNDALIDNLPQGCCVEVACLVDANGIQPTKVGTLPSHLAAMMQTNINVQTLLTEAIL
TENPERVYHAAMLDPHTAAVLGIEEIYALVDELIAEHGDWLPAWLHK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgtgacattctggcgttatccaaccttgcaatggagcgtcctgatgtctgca
cccaaaattacctttattggcgcgggttccactattttcgtcaaaaatatccttggcgat
gtctttcaccgcgatgcgctgaaatccgcccatatcgcgttgatggatattgatgcgacc
cggcttgaagagtcctttaccgtggtcagtaagctgatgagttcggctggtgcggccgga
agaatcacctgccacaccgaccagaaagcggcattagcggatgccgactttgttgtggtc
gcgtttcagataggcggctatgaaccctgtaccctcactgattttgcggtgtgtaagcgt
tacggtcttgagcagaccatcgccgacacgcttggcccgggcggcatcatgcgcgcgctg
cgcaccatcccgcacctctggcagatttgtgaagacatgacggcagtatgtcctgatgcc
accatgcttaattacgttaaccccatggcgatgaacacctgggcgatgtacgcgcgttat
ccgcatatcaaacaggttggcctgtgccattccgttcagggaacggcggaagagctggct
tacgatctcaatcttaacccggccgatttacgttaccgctctgccggcatcaaccacatg
gccttttacctggagctggagcgtaaaactgcagacggggcttacgtgaatctctacccg
gaactgcttgccgcttttgacgccgggcaggtaccgaaacccaacatgcatggcaatacg
cgctgtcccaacattgtgcgctatgagatgttcaaaaaactgggctatttcgtcaccgag
tcttcagaacattttgcagaatatacgccctggtttatcaagccgggacgagaggatctg
attgcgcgctaccagatcccgctggatgagtatcccaaacgctgcgtcgagcagttggat
aactggcgtaccgagcttgaacattacaagcgcgctgagcgtattgaaagcaaaccctcg
cgcgaatatgccagcgccattatgaatgccatctggacaggtgaaccggccgtgatttac
ggcaacgtgcgtaacgatgcattaatcgacaacctgccgcagggatgctgtgttgaggtc
gcctgcctggtggacgccaacgggattcagcctacgaaggtgggaaccctgccctcacat
ctggcagccatgatgcaaaccaatatcaacgtgcagacgctgctgaccgaagccatcctg
accgaaaaccctgagcgggtttaccacgcggccatgctggatccccatacggcggcggtg
ctgggcatcgaggagatttatgcgctggtggatgagctgatcgccgaacacggggactgg
ctgcccgcctggctgcacaaataa

DBGET integrated database retrieval system