KEGG   Pantoea ananatis AJ13355: PAJ_2519Help
Entry
PAJ_2519          CDS       T01969                                 

Gene name
oxyD
Definition
the C-terminal domain of asparagine synthase B, Ligand Binding site
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAJ_2519 (oxyD)
Enzymes [BR:paj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAJ_2519 (oxyD)
Peptidases [BR:paj01002]
 Cysteine Peptidases
  Family C44
   PAJ_2519 (oxyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3048916..3050754)
Genome map
AA seq 612 aa AA seqDB search
MCGIAGWSAFDNDLRAQSAIIDAMADSLSSRGPDERGIWLDKHIALGHRRLSILDLAHGQ
QPMFFYEAGKPVLAMVFCGEIYNFQSLRGMLEKESYSFRTRSDSEVLLSLYHRYRDEMFP
LLQGMFAVAIWDIPQNELTLGRDRLGIKPLNYVLKDQQIIFGSEPKALLCNPHCERITGP
DELCEILDMVKTPGKTSYKDMKELRPGEILKFSRHGARSSQYWNLCTAPHTDNQKLTCDK
VTALLEESIRSHLVSDVPISSLLSGGLDSSIIAVQGSRHLPGQLLTFSMDFTRNLSAFRA
DAVRSSPDELYARELAAFAGTAHESVLLNTEEIAAASVRDRVLEAVDSPPAYWGDMWPSM
YLLFRRIKEKSSVALSGEGADELFGGYRWFHNPAAIASETFPWLTPGSSRYFGGSGLFNE
EFINSLRMEEYRRARYEEAVREVTYLPGESDDEKAMRRISYLNITRFLQTLLDRNDRMSM
AAGVEVRVPFCDHRLVEYVYNIPWSMKNTRTQEKGLLRDATRQWLPADINERVKTPYPST
QDGAYEVLLRNELRRIIEDRNSPIHPYLNTERVIKNSQRKASELSLPYNRGSMEMVISMN
DWLRRYRVSIAI
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgccggctggtcagcattcgacaatgacttacgagcgcagagcgccatt
attgacgcaatggcagattccttgtcatcgcgtggtccggatgagcgaggaatatggctt
gataaacatattgcgcttggccatcggcggctgtcgatcctcgacctggcacatggccag
cagcccatgtttttttatgaagcaggcaagcctgttcttgcaatggtattctgcggcgaa
atctataattttcagtcgttacgcggcatgctggaaaaagagagttactcattccgcacc
cgctcggacagtgaggtactactttctctctaccaccgttatcgggatgagatgtttccc
ttattgcaaggcatgtttgcagtagcaatctgggacatcccccagaatgaactgacgtta
gggcgggaccgtcttggcatcaaacccctcaactatgttctcaaagatcagcaaatcatc
tttggttctgaaccgaaagctctgctctgtaaccctcattgcgagcggattacgggtccc
gatgaattgtgtgaaattctggatatggtaaaaacgcccgggaaaacatcctacaaggat
atgaaggaactacgtcccggtgaaatacttaaattcagtaggcacggtgcccgcagcagt
cagtactggaacctttgcactgctcctcatacggataatcagaaactcacgtgtgacaag
gttacagcactgcttgaggagtctattcgatctcacttagtttcagatgtacctatcagc
tcgctgctgtcaggtggactcgactcatcgataattgcggtacaaggaagccggcatctg
cccggacagctgcttactttctcaatggacttcactcgcaacctgtctgcgttcagagcg
gatgctgtccgttcatcgcctgatgaattgtatgcgcgagagcttgccgcgttcgcgggt
acggcacatgaatccgtactgcttaatacagaagaaatagcggccgcctctgttcgtgat
cgggtgctggaggccgtcgactcaccgccagcttactggggtgatatgtggccatcaatg
tatctgctctttcgtcgcattaaagagaaatccagcgtggcattatccggggagggggca
gatgagctctttggaggataccgctggtttcataacccagccgccattgcctcagagacc
ttcccatggctcacgcctggctcgtcacgatactttggtggctcgggattgtttaacgag
gagtttataaatagcctccggatggaggagtatcgtagagcccgctatgaagaagctgtg
agagaagtaacctatttgcctggtgaatctgatgacgaaaaagcaatgcgccgaatcagt
tatctcaatatcacccgctttcttcagacgctgcttgatcgcaatgaccgtatgagtatg
gccgccggtgtggaagttagagttccattctgtgaccaccgcttggtggagtatgtttac
aatattccctggagtatgaagaacacgcgcacacaggaaaaagggttgctgagagatgcc
acccggcagtggctgcccgcggatatcaatgagcgggttaaaacgccttatccttccact
caggacggcgcttacgaagttctgctgagaaatgaattaaggcggataatcgaggatcgc
aacagtcccattcatccttatttaaatactgagcgagtgataaaaaacagccaacgtaag
gcatcagaactgagcctcccttacaacagaggaagcatggaaatggtgatttcgatgaat
gactggctcaggcgttacagagtaagtattgcaatataa

DBGET integrated database retrieval system