KEGG   Pantoea ananatis AJ13355: PAJ_2522Help
Entry
PAJ_2522          CDS       T01969                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_2522
Enzymes [BR:paj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PAJ_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: BAK12602
UniProt: A0A0H3L3Z0
Position
complement(3053171..3053980)
Genome map
AA seq 269 aa AA seqDB search
MEAHNGLSAKIVEEEGFKAVWASGLSISTSLGLRDRNEVSWTQVIDVLEYMADSINIPIL
VDGDTGHGDFNNVRRFVKKLGQRNIGGVCFEDKQFPKTNSFLGENQELASIPEFTGKIKA
AIDTREHDDFCIIARTEALISGLGMSEALKRAEAYHAAGADAILVHSKKSTADEISGFMR
EWDNRCPIVIVPTKYFDTPVSLFEDIGISTVIWANHNLRSAITSMRETTRQIYRDKSIKA
AEGNIASLAEVFSLVNMDEIDAAEKKYSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccacaatggcctttctgcgaaaattgtggaggaagagggttttaaagctgtc
tgggcttctggcttatctatttcaacgtcactaggtcttagagatcgtaatgaggtttct
tggacgcaggttatcgatgtgctggagtatatggcagacagtataaacataccgattctg
gtcgatggtgataccggccatggtgattttaataatgtccgccgctttgtgaagaaactc
ggacagagaaacatcgggggagtttgctttgaagacaagcagttccctaagacgaattct
tttctaggtgagaatcaggaactggcttcaattccggagtttactgggaagattaaagca
gccattgatacgcgagaacatgacgatttttgtattattgccagaactgaggcgcttatc
tctggactggggatgtcagaggcacttaaacgcgcagaggcctaccatgctgcaggtgca
gatgccattctggttcattccaagaaaagcacagcagatgaaatttctggtttcatgcgc
gagtgggataatcgttgccctattgtcatcgtgccaacaaaatatttcgacactcccgtc
agcctgttcgaagatatcggcatttcaacggttatatgggccaatcacaacctccgttct
gccataacttcaatgcgtgaaacaacccgtcaaatttaccgggacaaatcaatcaaagcc
gctgagggcaatatagccagccttgctgaggttttttcacttgtaaatatggatgaaatc
gacgctgccgagaaaaagtattcggcttaa

DBGET integrated database retrieval system