KEGG   Pantoea ananatis AJ13355: PAJ_2547Help
Entry
PAJ_2547          CDS       T01969                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAJ_2547 (deoA)
Enzymes [BR:paj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PAJ_2547 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3085725..3086924)
Genome map
AA seq 399 aa AA seqDB search
MTIYFHDMSLPERVALTMAMRDSGTVLNWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVA
ACGGYIPMISGRGLGHTGGTLDKLEAIPGFDIFPSDDHFRQTIKQVGVAIIGQTNSLAPA
DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEASENLAQA
IVGVANGAGCRTTALLTDMNQVLASTAGNALEVREAVRFLTGAQRNPRLLEVTLALCSEM
LISGKLAENEAEAREKLMTVLDNGKAAEVFARMVAAQKGPSDFVERYDSYLPAPTMSKAV
YADRAGCVTHMDTRALGMAVVAMGGGRQRASDAIDYSVGLSDMITLGEQVDASRPLAVIH
ASSEAHWQQAAAAVKAAITLGERAPAATPVVYRRVTEAG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttattttcacgatatgtcgctgccggagcgggttgccctgacgatggcgatg
cgtgactcaggcaccgtgctgaactggaaatccctgaatcttaacgggccggtggtcgat
aagcactccaccggcggcgtcggcgatgtcacttcgctgatgctggggccaatggtggcc
gcctgtggcggctatatcccgatgatctcaggtcgcgggctggggcacaccggcggcacc
ctggacaagctggaagcgattcccgggtttgacattttccccagtgatgaccactttcgc
cagaccataaagcaggttggcgtggcaattattggccaaaccaactccctggccccggcg
gacaaacgcttttacgccacgcgcgacatcacggccaccgtggattcgattccgctgatc
accgcctcgattctggcgaaaaagctggccgaagggctggatgcgctggtgatggatgtc
aaagtcggctccggggcatttatgcccacgtatgaagcctctgaaaatctggcgcaggcc
attgttggcgtcgccaacggcgcgggctgtcgcaccacggcgctgttaacggatatgaac
caggtgctggcctccacggccggtaacgcgctggaagtgcgcgaagcagtgcgcttcctg
accggtgcgcagcgtaacccgcgcctgctggaagtgacgctggcgctgtgcagcgaaatg
ctgatctccggcaaactggcggaaaatgaggctgaggcacgcgaaaaactcatgacggta
ctggataacggcaaggccgcagaggtgtttgcccgcatggtggcggcgcagaagggcccg
agcgattttgttgagcgctacgacagctatttacctgcgccaacgatgagcaaagcggtt
tatgccgaccgggcaggctgtgttacccatatggatacccgcgcgctgggcatggcggtg
gtggcgatgggcggtggacgccagcgcgccagcgatgccatcgattacagcgtgggcctg
agcgacatgatcaccctgggcgagcaggtggatgcttcacgtccgctggcggtcatccat
gccagcagcgaagcgcactggcaacaggccgctgccgccgtaaaagccgcgattaccttg
ggtgagcgcgccccggcagccacgcctgtcgtgtatcgccgcgtcactgaggcaggctga

DBGET integrated database retrieval system