KEGG   Pantoea ananatis AJ13355: PAJ_2653Help
Entry
PAJ_2653          CDS       T01969                                 

Gene name
nucD3
Definition
lysozyme NucD3
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
paj  Pantoea ananatis AJ13355
Brite
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PAJ_2653 (nucD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3209359..3209868)
Genome map
AA seq 169 aa AA seqDB search
MSQTAKRCAVAAVLALAALLPQINMLKTSEAGLKLIADAEGCRTSPYQCSAGVWTNGIGH
TQGVTPTSVVNERQAAVNLVYDVMRVERGIDQCMPREMPYQVYDAVVSFGFNVGVHAACQ
STLAGLINSGRWHDACLQLKRWVYVKGTYNPGLDNRRQREMAWCLKGAA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagaccgctaaacgttgcgccgtggcggccgtactggccctggccgcgttgcta
ccgcaaatcaacatgctgaaaacctctgaagccggcctgaagctgattgccgatgcagaa
ggttgccgcacctcgccctatcagtgcagcgccggcgtctggaccaacggcattggtcac
acgcaaggtgttaccccgaccagtgtggtgaacgagcgtcaggccgcggtaaacctggtt
tacgacgtgatgcgcgttgaacgcgggatcgaccagtgcatgccacgtgaaatgccgtac
caggtttatgacgcggtggtgtcattcggttttaacgttggcgtgcacgccgcctgtcaa
tcaaccctggcgggattgatcaacagcggccgctggcacgatgcctgcctgcagcttaag
cgctgggtatatgtcaaaggcacctacaacccgggcctggataaccgtcgccagcgcgaa
atggcgtggtgtttaaaaggagcggcatga

DBGET integrated database retrieval system