KEGG   Pantoea ananatis AJ13355: PAJ_2744Help
Entry
PAJ_2744          CDS       T01969                                 

Gene name
cysQ
Definition
protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:paj00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3320187..3320942)
Genome map
AA seq 251 aa AA seqDB search
MRWKMLEQISQLAREAGDAIMQVYNGSVPTDVSHKADDSPVTAADLAAHDVIVSGLKQLT
PDIPVLSEEDPPGWEVRQHWHRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVMGVVY
APALGVMYSAAEGKAWKEENGERQQIHVLDARPPLVVVSRSHNDDDEMKEYLKQLGEHQT
VATGSSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVHDWQGRTLDYAPRES
FLNPGFRVSLF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggaaaatgttagagcaaataagccaactggcgcgtgaagcaggcgacgcgatt
atgcaggtctacaacggttccgttccgacagacgtttctcacaaagcggatgattctcct
gtcacggcggcagacctggccgctcatgatgtgattgtgtcgggcttaaaacagctgaca
ccggatattccggtgctgtcagaggaagatccgcccggctgggaggttcgccagcactgg
caccgttactggctggttgacccgctggatggcaccaaagaatttatcaaacgtaacggc
gaatttaccgtgaatattgcgctgattgagcagggcaaaccggtaatgggcgtggtttat
gctcccgcgctgggcgtgatgtattccgccgcagagggcaaagcctggaaagaagagaac
ggcgagcgacaacagattcatgtgcttgatgcgcgtccaccgttagtggtggtgagccgt
tcgcacaacgacgacgacgagatgaaagagtacctcaagcaactgggggaacatcagacg
gtggcaaccgggtcatcactgaagttttgcctggtggcagaagggaaagcacagctctat
ccgcgctttgggccaaccaatatttgggataccggagcgggtcatgccgttgccgcggcc
gcgggtgctcacgttcacgactggcagggaagaacactggactatgcaccgcgtgaatct
tttcttaatcccggctttcgcgtctcgctgttttaa

DBGET integrated database retrieval system