KEGG   Pantoea ananatis AJ13355: PAJ_2744Help
Entry
PAJ_2744          CDS       T01969                                 

Gene name
cysQ
Definition
(GenBank) protein CysQ
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00920  Sulfur metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAJ_2744 (cysQ)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PAJ_2744 (cysQ)
Transfer RNA biogenesis [BR:paj03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PAJ_2744 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: BAK12824
UniProt: A0A0H3L0K3
Position
complement(3320187..3320942)
Genome map
AA seq 251 aa AA seqDB search
MRWKMLEQISQLAREAGDAIMQVYNGSVPTDVSHKADDSPVTAADLAAHDVIVSGLKQLT
PDIPVLSEEDPPGWEVRQHWHRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVMGVVY
APALGVMYSAAEGKAWKEENGERQQIHVLDARPPLVVVSRSHNDDDEMKEYLKQLGEHQT
VATGSSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVHDWQGRTLDYAPRES
FLNPGFRVSLF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggaaaatgttagagcaaataagccaactggcgcgtgaagcaggcgacgcgatt
atgcaggtctacaacggttccgttccgacagacgtttctcacaaagcggatgattctcct
gtcacggcggcagacctggccgctcatgatgtgattgtgtcgggcttaaaacagctgaca
ccggatattccggtgctgtcagaggaagatccgcccggctgggaggttcgccagcactgg
caccgttactggctggttgacccgctggatggcaccaaagaatttatcaaacgtaacggc
gaatttaccgtgaatattgcgctgattgagcagggcaaaccggtaatgggcgtggtttat
gctcccgcgctgggcgtgatgtattccgccgcagagggcaaagcctggaaagaagagaac
ggcgagcgacaacagattcatgtgcttgatgcgcgtccaccgttagtggtggtgagccgt
tcgcacaacgacgacgacgagatgaaagagtacctcaagcaactgggggaacatcagacg
gtggcaaccgggtcatcactgaagttttgcctggtggcagaagggaaagcacagctctat
ccgcgctttgggccaaccaatatttgggataccggagcgggtcatgccgttgccgcggcc
gcgggtgctcacgttcacgactggcagggaagaacactggactatgcaccgcgtgaatct
tttcttaatcccggctttcgcgtctcgctgttttaa

DBGET integrated database retrieval system